Recombinant Human Myc Proto-Oncogene Protein (MYC) Protein (His-GST)

Beta LifeScience SKU/CAT #: BLC-11200P
Greater than 85% as determined by SDS-PAGE.
Greater than 85% as determined by SDS-PAGE.

Recombinant Human Myc Proto-Oncogene Protein (MYC) Protein (His-GST)

Beta LifeScience SKU/CAT #: BLC-11200P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human Myc Proto-Oncogene Protein (MYC) Protein (His-GST) is produced by our E.coli expression system. This is a protein fragment.
Purity Greater than 85% as determined by SDS-PAGE.
Uniprotkb P01106
Target Symbol MYC
Synonyms AU016757; Avian myelocytomatosis viral oncogene homolog; bHLHe39; c Myc; Cellular myelocytomatosis oncogene; Class E basic helix-loop-helix protein 39; MGC105490; MRTL; Myc; Myc protein; Myc proto oncogene protein; Myc proto-oncogene protein; myc-related translation/localization regulatory factor; MYC_HUMAN; Myc2; myca; MYCC; Myelocytomatosis oncogene a; Myelocytomatosis oncogene; Niard; Nird; oncogene c-Myc; Oncogene Myc; OTTHUMP00000158589; OTTHUMP00000227763; Proto-oncogene c-Myc; Protooncogene homologous to myelocytomatosis virus; RNCMYC; Transcription factor p64; Transcriptional regulator Myc-A; V-Myc avian myelocytomatosis viral oncogene homolog; v-myc myelocytomatosis viral oncogene homolog (avian); zc-myc
Species Homo sapiens (Human)
Expression System E.coli
Tag N-6His-GST
Target Protein Sequence SVCSTSSLYLQDLSAAASECIDPSVVFPYPLNDSSSPKSCASQDSSAFSPSSDSLLSSTESSPQGSPEPLVLHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESGSPSAGGHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSPRSSDTEENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLLRKRREQLKHKLEQLRNSCA
Expression Range 169-439aa
Protein Length Partial
Mol. Weight 61.7 kDa
Research Area Epigenetics And Nuclear Signaling
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Transcription factor that binds DNA in a non-specific manner, yet also specifically recognizes the core sequence 5'-CAC[GA]TG-3'. Activates the transcription of growth-related genes. Binds to the VEGFA promoter, promoting VEGFA production and subsequent sprouting angiogenesis. Regulator of somatic reprogramming, controls self-renewal of embryonic stem cells. Functions with TAF6L to activate target gene expression through RNA polymerase II pause release.
Subcellular Location Nucleus, nucleoplasm. Nucleus, nucleolus.
Database References

HGNC: 7553

OMIM: 113970

KEGG: hsa:4609

STRING: 9606.ENSP00000367207

UniGene: PMID: 30226609

  • lncRNA THOR is up-regulated in retinoblastoma, and its over-expression significantly enhances the malignant phenotype transformation of retinoblastoma cells by up-regulating c-myc and TGF2BP1 expression. PMID: 30119193
  • we demonstrate that neither MYC IHC nor MYC FISH alone is a sufficient screening mechanism for identification of the clinically relevant entities of HGBLwR or DEL PMID: 28868942
  • Because RPL23 is encoded by a target gene of c-Myc, the RPL23/Miz-1/c-Myc regulatory circuit provides a feedback loop that links efficient RPL23 expression with c-Myc's function to suppress Miz-1-induced Cdk inhibitors and thereby leads to apoptotic resistance in higher-risk myelodysplastic syndrome patients. PMID: 28539603
  • GATAD2B interacts with C-MYC to enhance KRAS driven tumor growth. PMID: 30013058
  • low expression of c-Myc protein predicts poor outcomes in patients with HCC with hepatectomy. PMID: 29690860
  • Combined, these findings suggest that c-Myc could transcriptionally regulate TCRP1 in cell lines and clinical samples and identified the c-Myc-TCRP1 axis as a negative biomarker of prognosis in tongue and lung cancers. PMID: 28623290
  • Kazakh and Han patients with esophageal squamous cell carcinoma with Glut1 c-myc co-expression had poorer prognosis. PMID: 29629851
  • MYC activation in papillary clear cell renal cell carcinoma leads to a worse prognosis. PMID: 28593993
  • could not find any relationship between Bcl-2, c-Myc and EBER-ISH positivity and the low/high IPS groups in classical Hodgkin lymphoma PMID: 29708579
  • Fluorescence in situ hybridization studies (histologic sections) confirmed translocations of MYC (8q24), BCL2 (18q21) and BCL6 (3q27) in all patients. PMID: 30043475
  • topical mevastatin accelerates wound closure by promoting epithelialization via multiple mechanisms: modulation of GR ligands and induction of the long noncoding RNA Gas5, leading to c-Myc inhibition. PMID: 29158265
  • CCND1 , C-MYC , and FGFR1 amplifications were observed in 34.28%, 28.57%, and 17.14% of the 35 samples (invasive ductal breast carcinoma). PMID: 30119151
  • Data suggest that MYC induction of REV-ERBalpha is both persistent and recurrent across many inducible MYC model systems. PMID: 28332504
  • HUWE1 overexpression could functionally suppress prostate carcinoma development both in vitro and in vivo, possibly by inverse regulation of c-Myc. PMID: 29966975
  • Menin functions as an oncogenic regulatory factor that is critical for MYC-mediated gene transcription. PMID: 28474697
  • High c-myc expression is associated with colorectal cancer. PMID: 30015962
  • Melatonin disturbs SUMOylation-mediated crosstalk between c-Myc and nestin via MT1 activation and promotes the sensitivity of paclitaxel in brain cancer stem cells. PMID: 29654697
  • FBP1 modulates the sensitivity of pancreatic cancer cells to BET inhibitors by decreasing the expression of c-Myc. These findings highlight FBP1 could be used as a therapeutic niche for patient-tailored therapies PMID: 30201002
  • miR135a directly bound to UCA1 and the 3' untranslated region of cmyc, and UCA1 competed with cmyc for miR135a binding. PMID: 30015867
  • MYC directly regulates DANCR and plays important role in cancer cell proliferation. PMID: 29180471
  • In this review, we provide support to the hypothesis that the cooperation of c-Myc with transcriptional cofactors mediates c-Myc-induced cellular functions. We produce evidence that recently identified cofactors are involved in c-Myc control of survival mechanisms of cancer cells PMID: 30261904
  • 4-chlorobenzoyl berbamine (CBBM) inhibits the JAK2/STAT3 pathway, leading to reduced c-Myc transcription. Collectively, these findings suggest that CBBM could be a promising lead compound for treatment of c-Myc-driven diffuse large B cell lymphoma. PMID: 30099568
  • Results revealed that C-MYC protein is highly expressed in colon cancer tissues, mainly in the cell nucleus and was identified as a direct target for mir-184. C-MYC appeared to participate in cell cycle regulation and malignant transformation to colon cancer. PMID: 28782841
  • MACC1 and c-Myc are highly expressed in serum and tumor tissues of EC patients. Both are correlated with TNM stage, primary infiltration, and lymph node or distal metastasis. PMID: 29984790
  • study provides an interesting example using chemical biological approaches for determining distinct biological consequences from inhibiting vs. activating an E3 ubiquitin ligase and suggests a potential broad therapeutic strategy for targeting c-MYC in cancer treatment by pharmacologically modulating cIAP1 E3 ligase activity. PMID: 30181285
  • The data demonstrated that 10058F4, a cMyc inhibitor, increased the growth inhibition, G0/G1 phase arrest and apoptosis of the NALM6 and CEM cells as induced by dexamethasone (DXM), a type of GC. PMID: 29749488
  • c-MYC/BCL2 protein co-expression is associated with non-germinal center B-cell in Diffuse Large B-Cell Lymphoma PMID: 29801406
  • c-Myc was capable of upregulating HP1gamma by directly binding to the E-box element in the first intron of HP1gamma gene, and the upregulated HP1gamma, in turn, repressed the expression of miR-451a by enhancing H3K9 methylation at the promoter region of miR-451a. PMID: 28967902
  • A subset of pancreatic acinar cell carcinomas shows c-MYC alterations including gene amplification and chromosome 8 polysomy. PMID: 29721608
  • Expression and Clinical Significance of LC-3 and P62 in Non-small Cell Lung Cancer PMID: 29945702
  • The findings of the current study demonstrate presence of the IDH1 R132H mutation in primary human glioblastoma cell lines with upregulated HIF-1alpha expression, downregulating c-MYC activity and resulting in a consequential decrease in miR-20a, which is responsible for cell proliferation and resistance to standard temozolomide treatment. PMID: 29625108
  • a novel signal circuit of Stat3/Oct-4/c-Myc was identified for regulating stemness-mediated Doxorubicin resistance in triple-negative breast cancer PMID: 29750424
  • MYC amplification and MYC overexpression occurred almost exclusively in secondary cutaneous angiosarcoma in our series. PMID: 29135507
  • High c-myc expression is associated with the development of prostate cancer. PMID: 29554906
  • Circular RNA hsa_circRNA_103809 promotes lung cancer progression via facilitating ZNF121-dependent MYC expression by sequestering miR-4302. PMID: 29698681
  • Authors conclude that quantitative measurements of intratumor heterogeneity by multiplex FISH, detection of MYC amplification and TP53 mutation could augment prognostication in breast cancer patients. PMID: 29181861
  • PCYT1A was upregulated by MYC, which resulted in the induction of aberrant choline metabolism and the inhibition of B-lymphoma cell necroptosis. PMID: 28686226
  • Cryptic t(3;8)(q27;q24) and/or MYC-BCL6 linkage associated with MYC expression by immunohistochemistry is frequent in multiple-hit B-cell lymphomas. PMID: 28665415
  • CD30+ diffuse large B-cell lymphoma has characteristic clinicopathological features mutually exclusive with MYC gene rearrangement and negatively associated with BCL2 protein expression. PMID: 29666157
  • High MYC amplification is associated with HER2 positive breast cancers in African American women. PMID: 29523126
  • These data suggest that MYC acts as a master coordinator that inversely modulates the impact of cell cycle and circadian clock on gene expression via its interaction with MIZ1. PMID: 27339797
  • In our study, the c-myc oncogene was amplified in 11.1% of BPH samples. Bivariate analysis failed to reveal any significant association between oncogene amplification and the clinicopathologic variables examined. PMID: 29234244
  • Genetic variation at the 8q24.21 renal cancer susceptibility locus affects HIF1A and HIF1B binding to a MYC enhancer. PMID: 27774982
  • Data indicate that miR-34a enhanced the sensitivity to cisplatin by upregulation of c-Myc and Bim pathway. PMID: 29060932
  • Luciferase reporter assay showed that c-Myc, an oncogene that regulating cell survival, angiogenesis and metastasis, was a direct target of miR-376a. Over-expression of miR-376a decreased the mRNA and protein levels of c-Myc in A549 cells. PMID: 28741879
  • The present findings show that expression of c-MYC has prognostic value in squamous cell carcinoma of the tongue, and could be useful in choice of therapy. PMID: 28393404
  • Multivariable analysis indicated that IPI (P = 0.002), chemotherapy regimens (P = 0.017), and MYC gene rearrangements (P = 0.004) were independent adverse prognostic factors for all diffuse large B cell Lymphoma(DLBCL) patients in this study. Results demonstrated that the poor survival of DLBCL patients with HBV infection was closely involved in chemotherapy regimens, IPI, and MYC gene rearrangements PMID: 29209623
  • MYC extra copy in diffuse large B-cell lymphoma is an independent poor prognostic factor PMID: 28776574
  • The c-Myc/miR-200b/PRDX2 loop regulates colorectal cancer (CRC) progression and its disruption enhances tumor metastasis and chemotherapeutic resistance in CRC. PMID: 29258530
  • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    Recently viewed