Recombinant Human Myc Proto-Oncogene Protein (MYC) Protein (His-GST)
Beta LifeScience
SKU/CAT #: BLC-11200P

Greater than 85% as determined by SDS-PAGE.
Recombinant Human Myc Proto-Oncogene Protein (MYC) Protein (His-GST)
Beta LifeScience
SKU/CAT #: BLC-11200P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Myc Proto-Oncogene Protein (MYC) Protein (His-GST) is produced by our E.coli expression system. This is a protein fragment. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | P01106 |
Target Symbol | MYC |
Synonyms | AU016757; Avian myelocytomatosis viral oncogene homolog; bHLHe39; c Myc; Cellular myelocytomatosis oncogene; Class E basic helix-loop-helix protein 39; MGC105490; MRTL; Myc; Myc protein; Myc proto oncogene protein; Myc proto-oncogene protein; myc-related translation/localization regulatory factor; MYC_HUMAN; Myc2; myca; MYCC; Myelocytomatosis oncogene a; Myelocytomatosis oncogene; Niard; Nird; oncogene c-Myc; Oncogene Myc; OTTHUMP00000158589; OTTHUMP00000227763; Proto-oncogene c-Myc; Protooncogene homologous to myelocytomatosis virus; RNCMYC; Transcription factor p64; Transcriptional regulator Myc-A; V-Myc avian myelocytomatosis viral oncogene homolog; v-myc myelocytomatosis viral oncogene homolog (avian); zc-myc |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | N-6His-GST |
Target Protein Sequence | SVCSTSSLYLQDLSAAASECIDPSVVFPYPLNDSSSPKSCASQDSSAFSPSSDSLLSSTESSPQGSPEPLVLHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESGSPSAGGHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSPRSSDTEENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLLRKRREQLKHKLEQLRNSCA |
Expression Range | 169-439aa |
Protein Length | Partial |
Mol. Weight | 61.7 kDa |
Research Area | Epigenetics And Nuclear Signaling |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Transcription factor that binds DNA in a non-specific manner, yet also specifically recognizes the core sequence 5'-CAC[GA]TG-3'. Activates the transcription of growth-related genes. Binds to the VEGFA promoter, promoting VEGFA production and subsequent sprouting angiogenesis. Regulator of somatic reprogramming, controls self-renewal of embryonic stem cells. Functions with TAF6L to activate target gene expression through RNA polymerase II pause release. |
Subcellular Location | Nucleus, nucleoplasm. Nucleus, nucleolus. |
Database References | HGNC: 7553 OMIM: 113970 KEGG: hsa:4609 STRING: 9606.ENSP00000367207 UniGene: PMID: 30226609 |