Recombinant Human Muscarinic Acetylcholine Receptor M3 (CHRM3) Protein (His-B2M)

Name: Recombinant Human Muscarinic Acetylcholine Receptor M3 (CHRM3) Protein (His-B2M)
Brand: Beta LifeScience
SKU: BLC-04057P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) CHRM3.

Collections: All products, Fc receptors, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Muscarinic Acetylcholine Receptor M3 (CHRM3) Protein (His-B2M) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P20309
Target Symbol	CHRM3
Synonyms	AChR; ACM3_HUMAN; cholinergic receptor muscarinic 3; CHRM 3; CHRM3; EGBRS; HM 3; HM3; m3 muscarinic acetylcholine receptor; M3 muscarinic receptor; muscarinic 3; Muscarinic acetylcholine receptor M3; muscarinic cholinergic m3 receptor; muscarinic m3 receptor
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His-B2M
Target Protein Sequence	RIYKETEKRTKELAGLQASGTEAETENFVHPTGSSRSCSSYELQQQSMKRSNRRKYGRCHFWFTTKSWKPSSEQMDQDHSSSDSWNNNDAAASLENSASSDEEDIGSETRAIYSIVLKLPGHSTILNSTKLPSSDNLQVPEEELGMVDLERKADKLQAQKSVDDGGSFPKSFSKLPIQLESAVDTAKTSDVNSSVGKSTATLPLSFKEATLAKRFALKTRSQITKRKRMSLVKEKKAAQT
Expression Range	253-492aa
Protein Length	Partial
Mol. Weight	40.7kDa
Research Area	Others
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	The muscarinic acetylcholine receptor mediates various cellular responses, including inhibition of adenylate cyclase, breakdown of phosphoinositides and modulation of potassium channels through the action of G proteins. Primary transducing effect is Pi turnover.
Subcellular Location	Cell membrane; Multi-pass membrane protein. Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein. Basolateral cell membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.
Protein Families	G-protein coupled receptor 1 family, Muscarinic acetylcholine receptor subfamily, CHRM3 sub-subfamily
Database References	HGNC: 1952 OMIM: 100100 KEGG: hsa:1131 STRING: 9606.ENSP00000255380 UniGene: PMID: 29864421 Regulation of molecular clock oscillations and phagocytic activity via muscarinic Ca(2+) signaling in human retinal pigment epithelial cells. PMID: 28276525 These results indicate that not H1 but M3 receptor-induced activation of p38 MAPK might contribute to the maintenance of epithelial barrier function through down-regulation of TNF-alpha signalling and activation of EGFR. PMID: 28412413 Morphine-induced MOP receptor endocytosis is facilitated by concurrent M3 activation.M3 and MOP assemble in receptor heterocomplexes mainly located at the plasma membrane.M3-MOP receptor pharmacological interaction is independent of heterocomplex formation.M3 and MOP receptor heteromers disrupt upon both receptor endocytosis. PMID: 28411124 this study shows that anti-M3R is significantly elevated in Sjogren's syndrome plasma in comparison with rheumatoid arthritis, systemic lupus erythematosus, and healthy controls PMID: 27460476 Interacting post-muscarinic receptor signaling pathways potentiate MMP1 expression and invasion of human colon cancer cells. PMID: 28008134 M3R expression plays an important role in early progression and invasion of colon neoplasia but is less important once tumors have spread. PMID: 28416748 This study presents the endocytic pathways of internalization for muscarinic type 3 receptor and flotillin-1/2 in salivary gland epithelial cells. knockdown of flot-1 or -2 by flotillin-specific siRNA prevented internalization and reduced the endocytic efficiency of muscarinic type 3 receptor. PMID: 27221048 M3-mAChR activation leads to enhancement of hsp expression via PKC-dependent phosphorylation of HSF1, thereby stabilizing the mutant hERG-FLAG protein. Thus, M3-mAChR activators may have a therapeutic value for patients with LQT2. PMID: 27803431 There were no significant associations between CHRM3 SNPs and autonomic nervous system activity in patients with schizophrenia on high-dose antipsychotics. PMID: 27923235 our findings support an oncogenic role for the M3 receptor in gastric cancer PMID: 26346168 To our knowledge, this is the first genetic association study that reveals the genetic contribution of CHRM3 gene in bladder cancer etiology. PMID: 28053981 The CHRM3 gene plays a role in abnormal thalamo-orbital frontal cortex functional connectivity in first-episode treatment-naive patients with schizophrenia. PMID: 26959877 These findings indicate that M3 mAChR may be important therapeutic target for obstructive airway diseases, as it regulates the effects of the epithelial-derived chemokines on ASM cell migration, which results in lung remodeling. PMID: 26956674 Blockading CHRM3 by shRNA or treatment with darifenacin inhibited prostate cancer growth. PMID: 26071486 results suggest that the autoantibodies against peptides of the second extracellular loop of M3R are not pathogenic in vivo and they are not suitable as biomarkers for pSS diagnosis PMID: 26901532 Report using biosensing techniques to monitor dynamic changes of inositol lipid pools in living cells reveals a PKC-dependent PtdIns4P increase upon EGF and M3 receptor activation. PMID: 26692031 M3 AChR or AMP-activated protein kinase Small Interfering RNA abrogated the ACh-elicited the attenuation of Endoplasmic reticulum stress in endothelial cells, indicating that the salutary effects of ACh were likely mediated by M3 AChR-AMPK signaling. PMID: 26066647 Suggest Gbeta4gamma1 as a modulator of M3 muscarinic receptor signaling. PMID: 25916507 Cigarette smoking may contribute to this imbalance by affecting the polarization and survival of Th/Tregs through the up-regulation of MR3 and MR5. PMID: 25375131 ACh-induced activation of EGFR/PI3K/AKT pathway and subsequent IL-8 upregulation may be one of the important mechanisms of M3R function PMID: 25964092 an incorrect organizational structure of many mutants of hM3R provides the molecular basis for why they are poorly expressed and fail to be effectively trafficked to the cell surface. PMID: 25769304 M3R preserves the endothelial barrier function through a mechanism potentially maintaining PTP1B activity, keeping the adherens junction proteins (AJPs) dephosphorylation. PMID: 24393526 Results uncovered that Gaq binding to GRK2 enhances the recruitment of GRK2 to M3-ACh receptors. PMID: 25316767 HM3-mediated IL8 expression through PKC-NFkappaB signaling pathways PMID: 24522860 Overexpression of muscarinic receptor 3 promotes metastasis in non-small-cell lung cancer. PMID: 24419413 The presence of muscarinic M3 receptor (HM3) autoantibodies may be related to the underlying disease mechanism in idiopathic generalized anhidrosis patients. PMID: 24334576 The M3 receptor facilitates interaction of the VE-cadherin-based adherens junctional complex and the actin-based cytoskeleton by maintaining Rac1 activity, which regulates the interaction between IQGAP1/Rac1 and IQGAP1/beta-catenin. PMID: 24697698 the M3 muscarinic receptor maximizes the efficiency of PLCbeta3 signaling beyond its canonical role as a guanine nucleotide exchange factor for Galpha. PMID: 24596086 M3-mediated contractions in the M2KO strain were decreased 54% by the protein kinase C (PKC) inhibitor chelerythrine. PMID: 23786223 Data indicate that high M3 muscarinic acetylcholine receptor (M3 receptor) expression correlates with poor survival in non-small cell lung cancer (NSCLC) patients, indicating that M3 receptor may be a novel antineoplastic target. PMID: 23838802 Our findings clearly indicate that binding of anti-M3R autoantibodies to the receptor, which was verified by immunoprecipitation, suppresses AQP5 trafficking to the membrane and contribute to impaired fluid secretion in SjS. PMID: 23382834 CHMR3 at the plasma membrane exists as stable dimeric complexes, a large fraction of which interact dynamically to form tetramers without the presence of trimers, pentamers or higher-order oligomers PMID: 23521066 The acetylcholine M3 receptor was slightly decreased as compared to control in overactive bladder. PMID: 22691178 Results suggest a major role of M(3) muscarinic receptors mediating the human gallbladder contraction through voltage-gated Ca(2+) channels and Rho kinase. PMID: 23227858 Overall, the results of the present study suggest that TNF--alpha causes (1) the release of ACh from A549 cells, (2) the decrease in cholinesterase activity, and (3) the upregulation of M3R expression facilitating the autocrine effects of ACh on M3R. PMID: 23142559 Generalized epilepsies implicates susceptibility genes: CHRM3 at 1q43, VRK2 at 2p16.1, ZEB2 at 2q22.3, SCN1A at 2q24.3 and PNPO at 17q21.32. PMID: 22949513 The expression of mAChR M3 is influenced by the extent of differentiation, distant metastasis and the site of cholangiocarcinoma. It also plays a key role in the proliferation and metastasis of cholangiocarcinoma. PMID: 22893470 CHRM3 and M(3) were suggested to play important roles in the pathogenesis of myopia and in the arrested progression of myopia by atropine. PMID: 22899762 The Asn-7.49 is important for the interaction between M(3)R and ARF1 and also for the formation of the ARF/Rho/beta gamma signaling complex, a complex that might determine the rapid activation and desensitization of PLD.(muscarinic acetylcholine receptor M3) PMID: 22178951 Mutation of this region in the M3-MR altered receptor coupling to G protein. PMID: 22466417 Its cytoprotective effect was decreased by a M3R antagonist. PMID: 22511543 The Asn-514-Tyr point mutation produces constitutive activation of muscarinic M3-AChR by decreasing the rate of receptor deactivation, while having minimal effect on receptor activation. PMID: 22564786 Data suggest that M3 muscarinic receptor and Kir6.1 colocalize to detrusor caveolae; studies include tissue from both male and female subjects. PMID: 22410194 The anti-M3RP205-220 antibody was detected in most patients with Sjogren syndrome. PMID: 22510450 The study reports the results of a combined computational and site mutagenesis study designed to provide new insights into the orthosteric binding site of the human M3 muscarinic acetylcholine receptor. PMID: 22500107 The data provide experimental evidence of the critical role that N-glycan chains play in determining muscarinic receptor distribution, localization, as well as PMID: 21798865 Autoantibodies against the second extra-cellular loop of M3R could be involved in salivary dysfunction in patients with Sjogren's syndrome. PMID: 21877253 Incubation of hSMG cells with pSS IgG (1mg/ml) significantly decreased M3R expression levels at the membrane. PMID: 22137887 Structural basis of M3 muscarinic receptor dimer/oligomer formation. PMID: 21685385

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.