Recombinant Human Mucin-7 (MUC7) Protein (His-PDI)

Beta LifeScience SKU/CAT #: BLC-06480P
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SDS-PAGE.

Recombinant Human Mucin-7 (MUC7) Protein (His-PDI)

Beta LifeScience SKU/CAT #: BLC-06480P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human Mucin-7 (MUC7) Protein (His-PDI) is produced by our Yeast expression system. This is a full length protein.
Purity Greater than 90% as determined by SDS-PAGE.
Uniprotkb Q8TAX7
Target Symbol MUC7
Species Homo sapiens (Human)
Expression System Yeast
Tag N-6His-PDI
Target Protein Sequence RERDHELRHRRHHHQSPKSHFELPHYPGLLAHQKPFIRKSYKCLHKRCRPKLPPSPNNPPKFPNPHQPPKHPDKNSSVVNPTLVATTQIPSVTFPSASTKITTLPNVTFLPQNATTISSRENVNTSSSVATLAPVNSPAPQDTTAAPPTPSATTPAPPSSSAPPETTAAPPTPSATTQAPPSSSAPPETTAAPPTPPATTPAPPSSSAPPETTAAPPTPSATTPAPLSSSAPPETTAVPPTPSATTLDPSSASAPPETTAAPPTPSATTPAPPSSPAPQETTAAPITTPNSSPTTLAPDTSETSAAPTHQTTTSVTTQTTTTKQPTSAPGQNKISRFLLYMKNLLNRIIDDMVEQ
Expression Range 23-377aa
Protein Length Full Length of Mature Protein
Mol. Weight 95.7 kDa
Research Area Others
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function May function in a protective capacity by promoting the clearance of bacteria in the oral cavity and aiding in mastication, speech, and swallowing. Binds P.aeruginosa pili.
Subcellular Location Secreted.
Database References

HGNC: 7518

OMIM: 158375

KEGG: hsa:4589

STRING: 9606.ENSP00000302021

UniGene: PMID: 27246755

  • High expression of MUC7 is associated with clear-cell renal cell carcinoma. PMID: 27683054
  • A capsule-free mutant of S. pneumoniae TIGR4 binds to salivary proteins, most prominently to mucin MUC7, but that this binding was not mediated through PsrP or recognition of sialic acid. PMID: 26172471
  • MUC7 glycosylation is altered in recurrent aphthous stomatitis. This may change the protective properties of this mucin against mucosal pathogens, which may effect this condition. PMID: 26051835
  • Results identified a reduction in glycosylation of MUC7 in Sjogren's primarily due to the loss of the extended core 2 disialylated structure, with and without fucosylation and suggest that MUC7 O-glycan changes in Sjogren's Syndrome may alter the physical properties of saliva, leading to the symptom of dry mouth. PMID: 26631508
  • The minimally invasive PTT procedure combined with Mucin 7 targeted GNPs is able to kill cancer cells and preserve healthy cells PMID: 25834826
  • MUC7 is a salivary mucin with antimicrobial activity against bacteria and fungi. PMID: 12543672
  • A significant increase in sulfation was identified in salivary MUC7 from rheumatoid arthritis patients. PMID: 23457413
  • The study did not show a correlation between the MUC7 genotypes and caries. PMID: 22706105
  • The present study did not disclose an association between MUC7*5/*6 and MUC7*6/*6 genotypes and gingival bleeding index. PMID: 23002673
  • expression of different numbers of terminal repeats in this salivary mucin in the oral environment does not interfere with the etiopathogenesis of aggressive or chronic periodontitis PMID: 22167029
  • MUC7 expression in ductal adenocarcinoma (DAC) and chronic pancreatitis was not statistically significant, but MUC7 could be considered as potential marker of malignant lesions, especially in pancreatic DAC, as it was positive in 73% of these cases. PMID: 21647207
  • A novel MUC7*5-generated variable number of tandem repeat (VNTR) polymorphism decreases the likelihood of a diagnosis of asthma in an African American population. PMID: 19820409
  • MUC5B and MUC7 from HIV patients, unlike the MUC5B and MUC7 from HIV negative individuals, did not inhibit HIV-1 activity. PMID: 20946627
  • Structure and biosynthesis of human salivary mucins. PMID: 11996097
  • Level of MG2 is lower in saliva of subjects with dental disease PMID: 12459324
  • binds to Streptococcus mutans alpha-enolase [MG2] PMID: 15501816
  • reported as new substrate for StcE protease of Escherichia coli O157-H7 in HEp-2 cells PMID: 15731026
  • Interactions between mucin and non-mucin proteins in saliva could protect complex partners from proteolysis PMID: 16203048
  • When the cells were treated with a panel of cytokines, epidermal growth factor, or a bacterial product (Pseudomonas aeruginosa lipopolysaccharide [LPS]), MUC7 transcripts and glycoprotein products were increased 1.7- to 3.2-fold. PMID: 16514118
  • Data demonstrate that TNF-alpha activates MUC7 transcription via NF-kappaB signaling pathway. PMID: 16778149
  • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    Recently viewed