Recombinant Human Mucin-5B (MUC5B) Protein (His&Myc)

Name: Recombinant Human Mucin-5B (MUC5B) Protein (His&Myc)
Brand: Beta LifeScience
SKU: BLC-01686P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Mucin-5B (MUC5B) Protein (His&Myc) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	Q9HC84
Target Symbol	MUC5B
Synonyms	MUC-5B;Cervical mucin;High molecular weight salivary mucin MG1;Mucin-5 subtype B, tracheobronchial;Sublingual gland mucin
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-10His&C-Myc
Target Protein Sequence	ELGQVVECSLDFGLVCRNREQVGKFKMCFNYEIRVFCCNYGHCPSTPATSSTAMPSSTPGTTWILTELTTTATTTASTGSTATPSSTPGTAPPPKVLTSPATTPTATSSK
Expression Range	4186-4295aa
Protein Length	Partial
Mol. Weight	18.9 kDa
Research Area	Cell Biology
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Gel-forming mucin that is thought to contribute to the lubricating and viscoelastic properties of whole saliva and cervical mucus.
Subcellular Location	Secreted.
Database References	HGNC: 7516 OMIM: 178500 KEGG: hsa:727897 STRING: 9606.ENSP00000436812 UniGene: PMID: 29440393 resistin induced MUC5AC and MUC5B expression via activation of different signaling pathways in human airway epithelial cells. PMID: 29604272 Genetic variations in the MUC5B gene can influence dental caries. PMID: 28944591 The expression of MUC5B mRNA increased with increases in NH concentration, and was significantly higher compared to that in untreated cells. H. pylori may affect the expression of MUC5AC, MUC2, MUC5B, and MUC6 in AGS cells via CagA and/or NH, but not E-cadherin. PMID: 29869461 MUC5B was identified as PRP-1 receptor in human chondrosarcoma JJ012 cell line using Ligand-receptor capture technology. PMID: 29138803 The MUC5B promoter polymorphism is strongly associated with interstitial lung abnormalities and specific radiologic subtypes of ILA, with varying degrees of heterogeneity in the underlying populations PMID: 28893869 The associations between MUC5B rs35705950 and short telomere length with extent of fibrosis, histopathological features of usual interstitial pneumonia, and reduced survival in patients with chronic hypersensitivity pneumonitis suggest shared pathobiology with IPF, and might help to stratify risk. PMID: 28648751 High-Mobility Group Box 1 Upregulates MUC5AC and MUC5B Expression in Primary Airway Epithelial Cells PMID: 29286856 IL-33 induced MUC5AC mRNA and MUC5AC protein, and also goblet cell hyperplasia at air liquid interface culture in human nasal epithelial cells. In addition to that, IL-33 induced MUC5B and FOXA3, and reduces FOXJmRNA. PMID: 27776277 MUC5B has physiologic functions in the mucus gel that ensure normal mucus clearance. PMID: 27845589 Down-regulation of MUC5B profoundly alters proliferation, migration and invasion of gastrointestinal cancer cells. PMID: 28972071 Mucins and AQP5 gene expression were significantly higher in patients with OME relative to controls. A 2-fold increase in MUC5B correlated with increased hearing loss (air-bone gap: 7.45 dB [95% CI, 2.65-12.24 dB]; sound field: 6.66 dB [95% CI, 6.63-6.69 dB]), effusion viscosity (2.75 mL/mg; 95% CI, 0.89-4.62 mL/mg), middle ear epithelial thickness (3.5 mum; 95% CI, 1.96-5.13 mum), and neutrophil infiltration (odds rat... PMID: 28594978 This study identified rare and common variants in the MUC5B gene that are associated with type 2 diabetes in Han Chinese. These findings suggest that dysregulated MUC5B expression may be involved in the pathogenesis of type 2 diabetes. PMID: 28346466 a critical regulatory domain that contains the MUC5B promoter variant and has a highly conserved forkhead box protein A2 (FOXA2) binding motif, is identified. PMID: 28272906 There is no evidence of major proteolytic processing of D-domains during the production of the mature secreted polymeric mucin in normal and cystic fibrosis primary bronchial epithelial cells. PMID: 26993521 Different rs35705950 SNP alleles are associated with different CT imaging phenotypes of pulmonary fibrosis. PMID: 26836909 MUC5B was significantly more often detected in middle ear effusion fluid relative to MUC5AC. MUC5B presence was statistically associated with mucoid effusions relative to serous effusions. PMID: 27729120 Results collectively indicate unique links between dual-specificity phosphatase 28 (DUSP28) and mucins MUC5B/MUC16 and their roles in pancreatic cancer. PMID: 27230679 Study provides evidence showing that MUC5B expression in cancer cells contributes to certain tumorigenic properties of breast cancer cells, such as cell growth, adhesion, clonogenic ability and drug chemo-resistance. PMID: 26984395 this study shows that histamine activated the NF-kappaB pathway, contributing to MUC5B overproduction and secretion in nasal epithelial cells PMID: 26574733 This study showed that MUC5B minor allele predisposes to poradic idiopathic pulmonary fi brosis (spIPF), familial interstitial pneumonia (FIP) and idiopathic non-speci fi c interstitial pneumonia. In spIPF, survival is not in fl uenced by MUC5B alleles. In FIP, MUC5B minor allele predicts better survival. PMID: 26699835 MUC5B may play a role in the development of pediatric fibrotic lung disease in patients with Surfactant Protein C mutations PMID: 25858779 the MUC5B polymorphism rs35705950 is associated with increased risk of idiopathic pulmonary fibrosis susceptibility, severity, and the decreased overall survival. PMID: 26823827 The MUC5B promoter polymorphism is the strongest and the most replicated genetic risk factor for Idiopathic pulmonary fibrosis. It is involved in disease pathogenesis through an increase in MUC5B expression in terminal bronchi and honeycombed cysts. PMID: 26595739 We propose a mechanism whereby MUC5B decreases surface tension lowering capacity of alveolar surfactant at areas with maximal mechanical stress PMID: 26539479 These results suggest that MUC5B production can be regulated by ECM components and that MUC5B is upregulated by fibronectin and laminin via the integrin, ERK, and NF-kappaB dependent pathway. PMID: 26057585 MUC5B promoter genotype was not associated with high attenuation areas on lung computed tomography. PMID: 26514822 Overexpression of MUC5B has been described in idiopathic pulmonary fibrosis lungs. Read More: http://www.atsjournals.org/doi/full/10.1164/rccm.201507-1322LE#.V2WAGNLrtNs PMID: 26871672 The variant allele of a common MUC5B promoter variant, rs35705950, is significantly associated with both familial and sporadic idiopathic pulmonary fibrosis. Read More: http://www.atsjournals.org/doi/full/10.1164/rccm.201509-1872LE#.V2WBpNLrtNs PMID: 26871673 Mucin 5B promoter polymorphism is associated with the risk for interstitial lung diseases mainly in older male Chinese subjects PMID: 25121989 MUC5B is a novel prognostic biomarker for patients with non-small cell lung cancer (NSCLC)carrying EGFR mutations but not for patients with NSCLC carrying wild-type EGFR PMID: 26224019 MUC5B has recently been shown to be associated with idiopathic pulmonary fibrosis susceptibility and survival. Read More: http://www.atsjournals.org/doi/full/10.1164/rccm.201505-1010OC#.VwqiYdLrvyA PMID: 26331942 strong association between the MUC5B promoter rs35705950 minor T allele and idiopathic pulmonary fibrosis susceptibility particularly evident in the Caucasian population, milder but still significant in the Asian population [meta-analysis] PMID: 26512610 this is the first study to successfully validate the association between rs35705950 and IPF in a Japanese ethnicity. PMID: 25581455 Increased expression of MUC5B was associated with bacterial biofilm formation in chronic rhinosinusitis patients. PMID: 25638393 MUC5B polymorphism confers susceptibility to idiopathic pulmonary fibrosis in Europeans and Asians--{review} PMID: 25926289 Both compounds down regulated mucin 5 subtype B, and peptidoglycan recognition protein 1 in vaginal tissue PMID: 25333937 the combination of MUC5B and TTF-1 expression is useful for discriminating adenocarcinomas from squamous cell carcinomas, yielding prognostic significance in patients with lung adenocarcinoma. PMID: 25733373 An increase of MUC5B abundance found in the sinus secretions of pediatric patients with chronic rhinosinusitis. PMID: 25420179 The T allele at rs35705950 of the MUC5B gene is associated with usual interstitial pneumonitis PMID: 25317858 The expression of a subset of mucins (MUC2, MUC6, MUC5B) was also correlated with sialyl-Tn expression in LS174T cells. PMID: 24840470 These results show for the first time that Staphylococcus enterotoxin A induces MUC5B expression via TLR2, ERK1/2, and p38 MAPK signaling pathway in human airway epithelial cells. PMID: 24717875 The MUC5B rs2672794 CC genotype was associated with a significantly increased risk of coal workers' pneumoconiosis, compared with the TT genotype. PMID: 24924948 Adolescents with very high intensity of dental caries disease had increased levels of MUC1 and MUC5B. PMID: 24441930 Sputum is not inert and degradation reduces apparent mucin concentrations and sputum elasticity. PMID: 24332705 These results suggest that visfatin induces MUC8 and MUC5B expression through p38 MAPK/ROS/NF-kappaB signaling pathway in human airway epithelial cells. PMID: 24885580 TSLP induces MUC5B expression via the ERK1/2 and p38 MAPK signaling pathway in human airway epithelial cells. PMID: 24792379 we report the expression pattern of MUC2, MUC5AC, MUC5B, and MUC6 in a large series of colorectal carcinomas PMID: 23807779 This study suggests that although both MUC5B and TERT polymorphisms confer independent risks for interstitial lung disease (ILD), MUC5B rs35705950 may, in particular, contribute differentially to idiopathic pulmonary fibrosis and other ILD entities. PMID: 24434656 One SNP in the MUC5B gene having association with chronic otitis media with effusion in study population. PMID: 23929584

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.