Recombinant Human Mucin-16 (MUC16) Protein (His), Active
Beta LifeScience
SKU/CAT #: BLC-05833P
Recombinant Human Mucin-16 (MUC16) Protein (His), Active
Beta LifeScience
SKU/CAT #: BLC-05833P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Mucin-16 (MUC16) Protein (His), Active is produced by our Mammalian cell expression system. This is a protein fragment. |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxin | Less than 1.0 EU/ug as determined by LAL method. |
| Activity | Measured by its binding ability in a functional ELISA. Immobilized MUC16 at 10 μg/ml can bind MSLN, the EC 50 is 460.7-662.2 ng/ml. |
| Uniprotkb | Q8WXI7 |
| Target Symbol | MUC16 |
| Synonyms | (MUC-16)(Ovarian cancer-related tumor marker CA125)(CA-125)(CA125) |
| Species | Homo sapiens (Human) |
| Expression System | Mammalian cell |
| Tag | C-6His |
| Target Protein Sequence | GFTHWIPVPTSSTPGTSTVDLGSGTPSSLPSPTTAGPLLVPFTLNFTITNLKYEEDMHCPGSRKFNTTERVLQSLLGPMFKNTSVGPLYSGCRLTLLRSEKDGAATGVDAICTHRLDPKSPGVDREQLYWELSQLTNGIKELGPYTLDRNSLYVNGFTHQTSAPNTSTPGTSTVDLGTSGTPSSLPSPTSAGPLLVPFTLNFTITNLQYEEDMHHPGSRKFNTTERVLQGLLGPMFKNTSVGLLYSGCRLTLLRPEKNGAATGM |
| Expression Range | 12660-12923aa |
| Protein Length | Partial |
| Mol. Weight | 30.5 kDa |
| Form | Lyophilized powder |
| Buffer | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Thought to provide a protective, lubricating barrier against particles and infectious agents at mucosal surfaces. |
| Subcellular Location | Cell membrane; Single-pass type I membrane protein. Secreted, extracellular space. Note=May be liberated into the extracellular space following the phosphorylation of the intracellular C-terminus which induces the proteolytic cleavage and liberation of the extracellular domain. |
| Database References | HGNC: 15582 OMIM: 606154 KEGG: hsa:94025 STRING: 9606.ENSP00000381008 UniGene: PMID: 29797475 |
