Recombinant Human Mucin-16 (MUC16) Protein (Fc-Myc)

Name: Recombinant Human Mucin-16 (MUC16) Protein (Fc-Myc)
Brand: Beta LifeScience
SKU: BLC-06124P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Collections: All products, Antibody / cell therapy targets, Antibody therapeutic / adc target proteins, Car-nk targets proteins, High-quality recombinant proteins, Recombinant cell therapy targets for car-t research

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Mucin-16 (MUC16) Protein (Fc-Myc) is produced by our Mammalian cell expression system. This is a protein fragment.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	Q8WXI7
Target Symbol	MUC16
Synonyms	CA125; CA-125; CA125 ovarian cancer antigen; Cancer antigen 125; FLJ14303; MUC 16; MUC-16; MUC16; MUC16_HUMAN; Mucin 16; Mucin 16 cell surface associated; Mucin-16; Mucin16; Ovarian cancer related tumor marker CA125; Ovarian cancer-related tumor marker CA125; Ovarian carcinoma antigen CA125
Species	Homo sapiens (Human)
Expression System	Mammalian cell
Tag	C-FC-Myc
Target Protein Sequence	GFTHWIPVPTSSTPGTSTVDLGSGTPSSLPSPTTAGPLLVPFTLNFTITNLKYEEDMHCPGSRKFNTTERVLQSLLGPMFKNTSVGPLYSGCRLTLLRSEKDGAATGVDAICTHRLDPKSPGVDREQLYWELSQLTNGIKELGPYTLDRNSLYVNGFTHQTSAPNTSTPGTSTVDLGTSGTPSSLPSPTSAGPLLVPFTLNFTITNLQYEEDMHHPGSRKFNTTERVLQGLLGPMFKNTSVGLLYSGCRLTLLRPEKNGAATGM
Expression Range	12660-12923aa
Protein Length	Partial
Mol. Weight	58.5 kDa
Research Area	Cancer
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Thought to provide a protective, lubricating barrier against particles and infectious agents at mucosal surfaces.
Subcellular Location	Cell membrane; Single-pass type I membrane protein. Secreted, extracellular space. Note=May be liberated into the extracellular space following the phosphorylation of the intracellular C-terminus which induces the proteolytic cleavage and liberation of the extracellular domain.
Database References	HGNC: 15582 OMIM: 606154 KEGG: hsa:94025 STRING: 9606.ENSP00000381008 UniGene: PMID: 29797475 The expression profile of studied Mucins MUC16 and MUC1 and truncated O-glycans was not associated with the site of origin of ovarian cancer (OVCA) cell lines PMID: 30011875 Serum HE4 with its high specificity is useful in ruling out ovarian malignancy especially among the premenopausal women and Risk of Ovarian Malignancy Algorithm (ROMA)which is the combination of both serum CA 125 and HE4, appears to be an all-rounder with overall good sensitivity and specificity especially among the postmenopausal women. PMID: 30063463 CA125 appears the most reliable biomarker for OC monitoring, whereas HE4 contributes additional information only in a minority of cases PMID: 30125544 The level of HE4 in ovarian cancer ascites may reflect the therapeutic effect of ovarian cancer patients, and a high level of HE4 might predict chemoresistance and the possibility of ascites formation. The determination of the expression of HE4 alone or combined with CA125 levels in both serum and ascites in ovarian cancer patients with ascites may have important significance for guiding and improving the treatment PMID: 29903044 Lower CA125 serum levels, negative vascular invasion, and wild-type BRAF status were significantly associated with improved 2-year DFS rates among patient with stage III disease who received adjuvant chemotherapy. PMID: 29562502 We can infer from this study that increased maternal serum CA 125 levels are associated with the preeclampsia and its severity. PMID: 29718786 Serum CA125 concentrations are correlated with coronary artery calcification score in the population without known coronary artery disease. PMID: 29731508 High serum CA125 level is associated with epithelial ovarian cancer. PMID: 28444641 Serum CA-125 was significantly different between infertile women with and without pelvic endometriosis. PMID: 29944231 Use of HE4 instead of CA125 did not significantly improve diagnostic performance of risk of malignancy indices 1-4 in patients with an adnexal mass PMID: 29238719 TP53 autoantibody levels provide a biomarker with clinically significant lead time over elevation of CA125 or an elevated ROCA value. Quantitative assessment of autoantibodies in combination with CA125 holds promise for earlier detection of invasive epithelial ovarian cancer PMID: 28637689 CA-125 levels may be the most useful marker for predicting advanced-stage disease PMID: 25761476 For screened women at familial/genetic ovarian cancer risk, risk of ovarian cancer algorithm had better early-stage sensitivity at high specificity, and low yet possibly acceptable positive predictive value compared with CA125 , warranting further larger cohort evaluation. PMID: 28143870 Serum SCC-Ag, hs-CRP, and CA-125 were higher in recurrence cervical patients which could be potential biomarkers for predicting cervical cancer recurrence risk. PMID: 28901315 The determination of CA125 before surgery may be helpful in the evaluation of the regional lymph nodes, and is a poor prognostic factor for overall survival and disease-free survival in endometrial cancer. PMID: 28624692 High CA125 expression is associated with adnexal malignancy. PMID: 27116243 The ratio between menstrual and midcycle phases had the worst performance. CA-125 may be useful for the diagnosis of deep endometriosis, especially when both are collected during menstruation and in midcycle. PMID: 28660213 Architect CA 125 II and HE4 values in Chinese women presenting with a pelvic mass PMID: 28549533 highly predictive of endometriosis in women with symptoms of pain and/or subfertility PMID: 27987404 HE4 seems to be superior to CA125 in the detection of recurrent disease. PMID: 29463191 High CA125 expression is associated with breast, endometrial and ovarian cancers. PMID: 26918940 knockdown of MUC16 significantly weakened the capabilities of cells for proliferation and migration PMID: 27167110 In this platinum-resistant population, PD was typically detected earlier by imaging than by CA-125, irrespective of bevacizumab treatment. Disease status by CA-125 at the time of PD was not prognostic for overall survival. Regular radiologic assessment as well as symptom benefit assessment should be considered during PROC follow-up. PMID: 27407100 Data characterized CA-125 kinetics and identified modeled kinetic parameters. PMID: 29187468 these studies demonstrate that PPARgamma is an important modulator of MUC16 expression. PMID: 27292441 These data point to a novel opportunity to enrich Abs at mucosal sites by targeting Abs to MUC16 through changes in Fc glycosylation, potentially blocking viral movement and sequestering the virus far from the epithelial border. PMID: 26960182 Within this review, we highlight both the processes involved in the expression of aberrant glycan structures on mucins, as well as the potential downstream impacts on cellular signaling. PMID: 27483328 In a cohort of patients with acute decompensated heart failure, cancer antigen 125 is independently associated with prolonged length of stay. PMID: 28265209 The current study uncovers the contribution of oncogenic KRAS to serum marker CA125 production through a mechanism that involves the ERK/c-Myc axis. PMID: 28108627 Mesothelin/mucin 16 signaling in activated portal fibroblasts regulates cholestatic liver fibrosis. PMID: 28287406 the loss of MUC16 and E-cadherin expression resulted in the formation of more compact spheroids. In addition, our data describe an unusual link between E-cadherin expression and less compact spheroids. Our data also emphasize the role of MUC16 and b1 integrin in Epithelial ovarian cancer (EOC) spheroid formation. PMID: 27612856 Preoperative CA-125 can predict neither the progression-free nor overall survival for primary serous ovarian cancer patients. PMID: 28551658 In pseudomyxoma peritonei CA125 was infrequently expressed by tumor cells, but in most of the cases adjacent nonneoplastic mesothelial cells. PMID: 27038681 Differences in the apparent expression levels of CEA, CA153 and CA125 in patients with nipple discharge and healthy persons were validated. PMID: 27327081 The endometrial expression of PR and Ki67 along with serum CA125 predicted the development of lymph node metastasis in endometrial cancer. PMID: 27163153 a distinct role for N-glycans in promoting MUC16's binding affinity toward galectin-3 and in causing retention of the lectin on the epithelial cell surface. PMID: 28487369 HE4 is elevated less frequently than CA125 in benign adnexal tumors, regardless of age or menopausal status PMID: 27752776 rebamipide induces the differential upregulation of MUC16 in stratified cultures of human corneal epithelial cells, which may have implications to the proper restoration of barrier function in ocular surface disease. PMID: 27725198 In postmenopausal women, CA-125 levels were significantly higher in those with epithelial ovarian cancer. PMID: 27855043 When the value of CA125 is higher than 10 U/ml and continuously increased, need to be vigilant and should be combined with imaging examination (PET-CT), early detection of recurrent lesions and early retreatment, especially maybe have the opportunity for surgery, this result may improve the prognosis for recurrent patients. PMID: 28284216 Pap test abnormalities are frequent in ECCC. Although it is less accurate in the diagnosis of ECCC than in the detection of malignancy, endometrial sampling is still the main procedure for the diagnosis of ECCC. Higher preoperative CA-125 concentrations imply the presence of advanced stage ECCC. PMID: 27173475 levels before treatment and decreased speed of decline of serum CA125 after treatment were independent factors. There is a negative correlation between pre-treatment CA125 level and prognosis, the sooner decrease of CA125 levels post-treatment the better prognosis are. PMID: 27629537 We found the high specificity of HE4 and CA125 while differentiating ovarian benign diseases from epithelial ovarian cancer in postmenopausal women and the high sensitivity of CA125 in detecting epithelial ovarian cancer in premenopausal patients PMID: 27436085 Results collectively indicate unique links between dual-specificity phosphatase 28 (DUSP28) and mucins MUC5B/MUC16 and their roles in pancreatic cancer. PMID: 27230679 that, in adenocarcinomas and borderline ovarian tumors, the major carriers of SLe(a) and SLe(x) are MUC16 and/or MUC1 (100 and 92 % for SLe(a) PMID: 27003157 A statistically significant difference was observed between HE4 values at primary diagnosis and at recurrence, respectively, comparing recurrent and non-recurrent patients while CA125 values resulted not statistically significant at each time point. PMID: 26531723 We assessed the diagnostic accuracy of a newly developed laboratory score-based on CA125, platelet count (PLT), C-reactive protein (CRP), and fibrinogen levels-in the preoperative diagnosis of adnexal mass PMID: 26499778 High CA125 expression is associated with Ovarian Tumors. PMID: 27268637 We evaluated the clinical performance of LOCItrade mark-based tumor marker assays CEA, CA19-9, CA15-3, CA125 and AFP in patients with gastrointestinal cancer and demonstrated their high diagnostic power PMID: 28011514

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.