Recombinant Human Mrna Export Factor (RAE1) Protein (GST)

Name: Recombinant Human Mrna Export Factor (RAE1) Protein (GST)
Brand: Beta LifeScience
SKU: BLC-04046P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Product Overview

Description	Recombinant Human Mrna Export Factor (RAE1) Protein (GST) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P78406
Target Symbol	RAE1
Synonyms	dJ481F12.3; dJ800J21.1; FLJ30608; Homolog of yeast Rae1 (Bharathi) mRNA associated protein of 41 kDa (Kraemer); Homolog of yeast Rae1 mRNA associated protein of 41 kDa; MGC117333; MGC126076; MGC126077; MIG 14; MIG14; Migration inducing gene 14; Mnrp 41; Mnrp41; mRNA associated protein mrnp 41; mRNA binding protein 41 kD; mRNA export factor; mRNA export protein; mRNA-associated protein mrnp 41; MRNP 41; MRNP41; RAE 1; RAE1 (RNA export 1 S.pombe) homolog; rae1; RAE1 homolog; Rae1 protein homolog; RAE1 RNA export 1 homolog (S. pombe); RAE1 RNA export 1 homolog; RAE1L_HUMAN; RNA export 1; RNA export 1 homolog
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-GST
Target Protein Sequence	MSLFGTTSGFGTSGTSMFGSATTDNHNPMKDIEVTSSPDDSIGCLSFSPPTLPGNFLIAGSWANDVRCWEVQDSGQTIPKAQQMHTGPVLDVCWSDDGSKVFTASCDKTAKMWDLSSNQAIQIAQHDAPVKTIHWIKAPNYSCVMTGSWDKTLKFWDTRSSNPMMVLQLPERCYCADVIYPMAVVATAERGLIVYQLENQPSEFRRIESPLKHQHRCVAIFKDKQNKPTGFALGSIEGRVAIHYINPPNPAKDNFTFKCHRSNGTNTSAPQDIYAVNGIAFHPVHGTLATVGSDGRFSFWDKDARTKLKTSEQLDQPISACCFNHNGNIFAYASSYDWSKGHEFYNPQKKNYIFLRNAAEELKPRNKK
Expression Range	1-368aa
Protein Length	Full Length
Mol. Weight	68.0kDa
Research Area	Others
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Plays a role in mitotic bipolar spindle formation. Binds mRNA. May function in nucleocytoplasmic transport and in directly or indirectly attaching cytoplasmic mRNPs to the cytoskeleton.
Subcellular Location	Cytoplasm. Nucleus. Cytoplasm, cytoskeleton, spindle pole.
Protein Families	WD repeat rae1 family
Database References	HGNC: 9828 OMIM: 603343 KEGG: hsa:8480 STRING: 9606.ENSP00000360286 UniGene: Hs.371698

Gene Functions References

RAE1 overexpression was associated with considerably poorer disease-free survival and distant metastasis-free survival, especially in patients with oestrogen receptor-positive tumours. PMID: 28181567
show that USP11 is associated with the mitotic spindle, does not regulate SAC inactivation, but controls ubiquitination of RAE1 at the mitotic spindle, hereby functionally modulating its interaction with Nuclear Mitotic Apparatus protein (NuMA). PMID: 29293652
Nuclear export inhibition by ORF10 of human herpesvirus 8 requires an interaction with an RNA export factor, Rae1. PMID: 27832591
After PSK administration, INF-g production in CD8(+) T cells increased in mice with cells expressing neither Rae-1 nor H60, but did not change in mice implanted with cells expressing both Rae-1 and H60. We demonstrated that the expression of NKG2DLs affects tumor immunity and the efficacy of immuno therapy in tumor-bearing mouse model PMID: 28739693
Vesiculoviral matrix (M) protein occupies nucleic acid binding site at nucleoporin pair (Rae1 * Nup98). PMID: 24927547
vesicular stomatitis virus M protein interacted efficiently with Rae1-Nup98 complexes associated with the chromatin fraction of host nuclei, consistent with an effect on host transcription PMID: 23028327
mouse cytomegalovirus m152/gp40 interaction with RAE1gamma structural analysis reveals a paradigm for MHC/MHC interaction in immune evasion PMID: 23169621
This study established a novel postmitotic function for rae-1 in neuronal development. PMID: 22357847
RAE1 transgene orchestrates proper chromosome segregation and NUP98-mediated leukemogenesis. PMID: 21467841
In a transgenic mouse model of chronic natural killer NKG2D ligand expression, constant exposure to NKG2D ligand RNA export 1 homolog (Rae-1 epsilon) does not functionally impair NK cells or CD8-positive T cells in the context of viral infection. PMID: 20530257
present the crystal structure of human Rae1 in complex with the Gle2-binding sequence (GLEBS) of Nup98 at 1.65 A resolution. Rae1 forms a seven-bladed beta-propeller with several extensive surface loops. PMID: 20498086
These data show an association of mrnp41 with MT and, moreover, demonstrate that an intact MT system is necessary for dispersion of mrnp41-containing particles to the cellular periphery PMID: 11831386
VSV M protein blocks mRNA export by disrupting Rae1 function, which can be reverted by induction of Rae1 expression. PMID: 15629720
A purified Rae1 complex stabilizes microtubules in egg extracts in a RanGTP/importin beta-regulated manner PMID: 15851029
point to the Rae1-NuMA interaction as a critical element for normal spindle formation in mitosis PMID: 17172455
Retinoic acid downregulates Rae1 leading to APC(Cdh1) activation and neuroblastoma SH-SY5Y differentiation. PMID: 18212744

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.