Recombinant Human Monocyte Differentiation Antigen Cd14 (CD14) Protein (His-Myc)
Recombinant Human Monocyte Differentiation Antigen Cd14 (CD14) Protein (His-Myc)
Submit an inquiry or email sales for a custom bulk quote. Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
| Description | Recombinant Human Monocyte Differentiation Antigen Cd14 (CD14) Protein (His-Myc) is produced by our Mammalian cell expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P08571 |
| Target Symbol | CD14 |
| Synonyms | CD 14; CD_antigen=CD14; CD14; CD14 antigen; CD14 molecule; CD14_HUMAN; LPS-R; Mo2; Monocyte differentiation antigen CD14; Monocyte differentiation antigen CD14 urinary form; Monocyte differentiation antigen CD14; membrane-bound form; Myeloid cell specific leucine rich glycoprotein; Myeloid cell-specific leucine-rich glycoprotein |
| Species | Homo sapiens (Human) |
| Expression System | Mammalian cell |
| Tag | N-6His-Myc |
| Target Protein Sequence | TTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMN |
| Expression Range | 20-345aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 39.2kDa |
| Research Area | Immunology |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Coreceptor for bacterial lipopolysaccharide. In concert with LBP, binds to monomeric lipopolysaccharide and delivers it to the LY96/TLR4 complex, thereby mediating the innate immune response to bacterial lipopolysaccharide (LPS). Acts via MyD88, TIRAP and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. Acts as a coreceptor for TLR2:TLR6 heterodimer in response to diacylated lipopeptides and for TLR2:TLR1 heterodimer in response to triacylated lipopeptides, these clusters trigger signaling from the cell surface and subsequently are targeted to the Golgi in a lipid-raft dependent pathway. Binds electronegative LDL (LDL(-)) and mediates the cytokine release induced by LDL(-). |
| Subcellular Location | Cell membrane; Lipid-anchor, GPI-anchor. Secreted. Membrane raft. Golgi apparatus. |
| Database References | HGNC: 1628 OMIM: 158120 KEGG: hsa:929 STRING: 9606.ENSP00000304236 UniGene: PMID: 29795672 |

