Recombinant Human Mob Kinase Activator 1A (MOB1A) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-10151P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Mob Kinase Activator 1A (MOB1A) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-10151P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Mob Kinase Activator 1A (MOB1A) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | Q9H8S9 |
| Target Symbol | MOB1A |
| Synonyms | B1; Mps One Binder kinase activator like 1B (yeast); C2orf6 ; Chromosome 2 open reading frame 6; FLJ10788; FLJ11595; MATS1 ; MOB kinase activator 1A; MOB1 ; Mob1 alpha; Mob1 homolog 1B; MOB1 Mps One Binder homolog A; MOB1 Mps One Binder kinase activator like 1B; Mob1A; MOB4B ; Mob4B protein; MOBK1B; Mobkl1b; MOL1B_HUMAN; Mps one binder kinase activator like 1B; Mps one binder kinase activator-like 1B; Protein Mob4B |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-6His-SUMO |
| Target Protein Sequence | SFLFSSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRQAVMLPEGEDLNEWIAVNTVDFFNQINMLYGTITEFCTEASCPVMSAGPRYEYHWADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDSVMQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKLGSKDR |
| Expression Range | 2-216aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 40.9kDa |
| Research Area | Signal Transduction |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Activator of LATS1/2 in the Hippo signaling pathway which plays a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein STK3/MST2 and STK4/MST1, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ. Phosphorylation of YAP1 by LATS1/2 inhibits its translocation into the nucleus to regulate cellular genes important for cell proliferation, cell death, and cell migration. Stimulates the kinase activity of STK38 and STK38L. Acts cooperatively with STK3/MST2 to activate STK38. |
| Protein Families | MOB1/phocein family |
| Database References | HGNC: 16015 OMIM: 609281 KEGG: hsa:55233 STRING: 9606.ENSP00000379364 UniGene: PMID: 28675297 |
