Recombinant Human Mitogen-Activated Protein Kinase Kinase Kinase 14 (MAP3K14) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-01737P
Greater than 85% as determined by SDS-PAGE.
Recombinant Human Mitogen-Activated Protein Kinase Kinase Kinase 14 (MAP3K14) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-01737P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Mitogen-Activated Protein Kinase Kinase Kinase 14 (MAP3K14) Protein (His&Myc) is produced by our E.coli expression system. This is a protein fragment. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | Q99558 |
| Target Symbol | MAP3K14 |
| Synonyms | Serine/threonine-protein kinase NIK NF-kappa-beta-inducing kinase |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-10His&C-Myc |
| Target Protein Sequence | ATHQLRLGRGSFGEVHRMEDKQTGFQCAVKKVRLEVFRAEELMACAGLTSPRIVPLYGAVREGPWVNIFMELLEGGSLGQLVKEQGCLPEDRALYYLGQALEGLEYLHSRRILHGDVKADNVLLSSDGSHAALCDFGHAVCLQPDGLGKSLLTGDYIPGTETHMAPEVVLGRSCDAKVDVWSSCCMMLHMLNGCHPWTQFFRGPLCLKIASEPPPVREIPPSCAPLTAQAIQEGLRKEPIHRVSAAELGGKVNRAL |
| Expression Range | 400-655aa |
| Protein Length | Partial |
| Mol. Weight | 35.4 kDa |
| Research Area | Biochemicals |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Lymphotoxin beta-activated kinase which seems to be exclusively involved in the activation of NF-kappa-B and its transcriptional activity. Promotes proteolytic processing of NFKB2/P100, which leads to activation of NF-kappa-B via the non-canonical pathway. Could act in a receptor-selective manner. |
| Subcellular Location | Cytoplasm. |
| Protein Families | Protein kinase superfamily, STE Ser/Thr protein kinase family, MAP kinase kinase kinase subfamily |
| Database References | HGNC: 6853 OMIM: 604655 KEGG: hsa:9020 UniGene: PMID: 30018345 |
