Recombinant Human Mitochondrial Peptide Methionine Sulfoxide Reductase (MSRA) Protein (His)

Name: Recombinant Human Mitochondrial Peptide Methionine Sulfoxide Reductase (MSRA) Protein (His)
Brand: Beta LifeScience
SKU: BLC-10065P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Product Overview

Description	Recombinant Human Mitochondrial Peptide Methionine Sulfoxide Reductase (MSRA) Protein (His) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	Q9UJ68
Target Symbol	MSRA
Synonyms	Cytosolic methionine S sulfoxide reductase ; Methionine sulphoxide reductase A; Mitochondrial peptide methionine sulfoxide reductase; MSR A; msrA; MSRA_HUMAN; peptide met (O) reductase; Peptide Met(O) reductase; Peptide methionine (S) S oxide reductase; Peptide-methionine (S)-S-oxide reductase; PMSR; Protein methionine S oxide reductase; Protein-methionine-S-oxide reductase
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His
Target Protein Sequence	GNSASNIVSPQEALPGRKEQTPVAAKHHVNGNRTVEPFPEGTQMAVFGMGCFWGAERKFWVLKGVYSTQVGFAGGYTSNPTYKEVCSEKTGHAEVVRVVYQPEHMSFEELLKVFWENHDPTQGMRQGNDHGTQYRSAIYPTSAKQMEAALSSKENYQKVLSEHGFGPITTDIREGQTFYYAEDYHQQYLSKNPNGYCGLGGTGVSCPVGIKK
Expression Range	24-235aa
Protein Length	Full Length of Mature Protein
Mol. Weight	27.5kDa
Research Area	Metabolism
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Has an important function as a repair enzyme for proteins that have been inactivated by oxidation. Catalyzes the reversible oxidation-reduction of methionine sulfoxide in proteins to methionine.
Subcellular Location	[Isoform 1]: Mitochondrion.; [Isoform 2]: Cytoplasm.; [Isoform 3]: Cytoplasm. Nucleus.; [Isoform 5]: Cytoplasm. Membrane; Lipid-anchor.
Protein Families	MsrA Met sulfoxide reductase family
Database References	HGNC: 7377 OMIM: 601250 KEGG: hsa:4482 STRING: 9606.ENSP00000313921 UniGene: Hs.490981
Tissue Specificity	Ubiquitous. Highest expression in adult kidney and cerebellum, followed by liver, heart ventricles, bone marrow and hippocampus.

Gene Functions References

Data show that miR-193b, by directly targeting focal adhesion kinase (FAK), CRK-like proto-oncogene (CRKL), and methionine sulfoxide reductase A (MSRA), regulates focal adhesion signaling and ROS signaling, which play pivotal roles in liposarcomagenesis and adipogenic differentiation. PMID: 28882999
this study we have identified, for the first time, compounds structurally related to the natural products fusaricidins that markedly activate recombinant bovine and human MsrA and human MsrB. PMID: 26718410
The association of MsrA haplotypes with executive functions indicated that MsrA is associated with executive function defects in bipolar I disorder patients. PMID: 26117066
Silencing the expression of the main Msr elements-MsrA, MsrB1, or MsrB2 exacerbates sensitivity toward oxidative stress. PMID: 23988788
ARD1 has a crucial role in the cellular response to oxidative stress as a bona fide regulator of MSRA. PMID: 25341044
The functional MSRA rs10903323 G/A polymorphism is associated with coronary artery disease development. PMID: 23880405
We hypothesize that the activity of MsrA can be employed as a marker for the isolation of stem and progenitor cell subpopulations for cell therapy applications. PMID: 23415806
The MSRA rs10903323 G/A variant allele is associated with Rheumatoid Arthritis development, especially among male patients, older patients, C-Reactive Protein-positive patients, and anti-cyclic citrullinated peptide negative patients. PMID: 23244167
The MSRA rs10903323 gene polymorphism may be implicated in the increased risk to develop cardiovascular events, in particular ischaemic heart disease, observed in rheumatoid arthritis patients. PMID: 22657383
Mammalian and yeast MSRA reduced free methionine sulfoxide much more efficiently than MSRB. PMID: 22867795
Data show that glutaredoxin acts as a reductant for methionine sulfoxide reductases A and B (MsrA and MsrB) with or without resolving cysteine. PMID: 22634633
The haplotype with the lowest P value showed association with Meconium ileus in an independent sample of 1,335 unrelated cystic fibrosis patients PMID: 22438829
The MSRA gene located on chromosome 8 was found to be associated with the phenotype of schizophrenia in Chinese first-episode schizophrenia patients. PMID: 21679298
central obesity-associated variants in LYPLAL1, NRXN3, MSRA, and TFAP2B PMID: 21674055
Data suggest a critical role for TXNL6 in MsrA repair of essential lens proteins under oxidative stress conditions and that TXNL6 is important for MsrA defense protection against cataract. PMID: 21079812
Our findings indicate that a novel association in the MSRA gene is related to oxidative stress and support the notion of a major role for this process in rheumatoid arthritis. PMID: 20617525
reduction of MsrA levels results in increased cell proliferation and extracellular matrix degradation, and consequently in a more aggressive cellular phenotype in breast cancer cells PMID: 20937881
Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator) PMID: 20421936
Dual sites of protein initiation control the localization and myristoylation of methionine sulfoxide reductase A PMID: 20368336
protein-specific autoantibody are associated with pulmonary fibrosis and renal vascular damage in systemic sclerosis PMID: 19844733
FOXO3a directly activates the human MsrA promoter in a cell culture system, implying that this could be a conserved mechanism of MsrA regulation. PMID: 19747232
MSRA is down-regulated during cell aging. PMID: 14759519
MsrA is present throughout the human lens, where it is likely to defend lens cells and their components against methionine oxidation PMID: 15199188
The cloning and characterization of the 5' promoter region of human msrA are reported. PMID: 16162094
MsrA may play an important role in cellular defenses against oxidative stress and in protection against death by limiting the accumulation of oxidative damage to proteins PMID: 16257642
showed the expression and function of both sulfoxide reductases together with thioredoxin reductase in the cytosol as well as in the nucleus of epidermal melanocytes which are especially sensitive to reactive oxygen PMID: 16480945
MSRA gene on chromosome 8p might possess metastasis suppressor activity in HCC. PMID: 17784942
Methionine sulfoxide reductases A and B are seriously affected by hydrogen peroxide accumulation in acute vitiligo. PMID: 17943184
this work points towards MSRA as a novel schizophrenia candidate gene PMID: 18506707
Retinoic acid regulates transcription of MSRA gene via two distinct promoters via retinoic acid receptors. PMID: 18845237
This suggests an important role for an MSRA catalytic antioxidant cycle for protection of the cytoplasmic compartment against oxidative damage. PMID: 19085252
almost absent catalase and methionine sulfoxide reductase A and B protein expression in human gray/white scalp hair shafts in association with a functional loss of methionine sulfoxide repair in the entire gray hair follicle PMID: 19237503
MSR enzymes are differentially expressed in human skin PMID: 19542914
TFAP2B, LYPLAL1 and MSRA are associated with adiposity and fat distribution. PMID: 19557161
Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator) PMID: 19557161

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.