Recombinant Human Mitochondrial Import Receptor Subunit Tom40 Homolog (TOMM40) Protein (GST)

Name: Recombinant Human Mitochondrial Import Receptor Subunit Tom40 Homolog (TOMM40) Protein (GST)
Brand: Beta LifeScience
SKU: BLC-03926P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) TOMM40.

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Product Overview

Description	Recombinant Human Mitochondrial Import Receptor Subunit Tom40 Homolog (TOMM40) Protein (GST) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	O96008
Target Symbol	TOMM40
Synonyms	C19orf1; D19S1177E; Haymaker protein; Mitochondrial import receptor subunit TOM40 homolog; Mitochondrial outer membrane protein; Mitochondrial outer membrane protein TOM40; p38.5; PER EC1; PEREC1; Probable mitochondrial import receptor subunit TOM40 homolog; Protein Haymaker; TOM40; TOM40_HUMAN; TOMM40; Translocase of outer membrane 40 kDa subunit homolog; Translocase of outer mitochondrial membrane 40; Translocase of outer mitochondrial membrane 40 homolog (yeast); Translocase of outer mitochondrial membrane 40 homolog; Translocase of outer mitochondrial membrane 40, yeast, homolog of
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-GST
Target Protein Sequence	MGNVLAASSPPAGPPPPPAPALVGLPPPPPSPPGFTLPPLGGSLGAGTSTSRSSERTPGAATASASGAAEDGACGCLPNPGTFEECHRKCKELFPIQMEGVKLTVNKGLSNHFQVNHTVALSTIGESNYHFGVTYVGTKQLSPTEAFPVLVGDMDNSGSLNAQVIHQLGPGLRSKMAIQTQQSKFVNWQVDGEYRGSDFTAAVTLGNPDVLVGSGILVAHYLQSITPCLALGGELVYHRRPGEEGTVMSLAGKYTLNNWLATVTLGQAGMHATYYHKASDQLQVGVEFEASTRMQDTSVSFGYQLDLPKANLLFKGSVDSNWIVGATLEKKLPPLPLTLALGAFLNHRKNKFQCGFGLTIG
Expression Range	1-361aa
Protein Length	Full Length
Mol. Weight	64.9kDa
Research Area	Tags & Cell Markers
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Channel-forming protein essential for import of protein precursors into mitochondria. Plays a role in the assembly of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) by forming a complex with BCAP31 and mediating the translocation of Complex I components from the cytosol to the mitochondria.
Subcellular Location	Mitochondrion outer membrane; Multi-pass membrane protein.
Protein Families	Tom40 family
Database References	HGNC: 18001 OMIM: 608061 KEGG: hsa:10452 STRING: 9606.ENSP00000252487 UniGene: Hs.655909

Gene Functions References

TOM40 over-expression blocked Ab-elicited decreases in the mitochondrial membrane potential, cellular ATP levels, and cellular viability in the control cells. These data suggest elevated expression of TOM40 may be protective of mitochondrial function. PMID: 28768149
PPARgamma knockdown resulted in increased levels of TOMM40, APOE and APOC1 -mRNAs, showing the strongest impact on APOE transcript levels. PMID: 28065845
Results from this exploratory analysis suggest that regulatory element methylation levels within the larger TOMM40-APOE-APOC2 gene region correlate with AD-related biomarkers and TOMM40 or APOE gene expression in AD. PMID: 29371683
This study demonstrated that the association of TOMM40 '523-L with cognitive decline is primarily mediated by common neuropathologies. By contrast, the association of TOMM40 '523-S/S is relatively independent of these pathologies. PMID: 28624335
This study found in middle-aged and aged cohorts that FH altered TOMM40 '523 poly-T genotype associations on memory, and additionally in aged participants for both global decline and cognitive impairment risk. PMID: 28549947
Our data provide support for TOMM40 variant repeat length as an important contributor to AD-like Medial Temporal Lobe pathology in the absence of APOE epsilon4. PMID: 28183529
Survival analyses suggest that AD patients with TOMM40 allele rs2075650-G have an average age of disease onset of 6 years earlier compared with carriers of the A allele. The age of disease onset is earlier if APOE4/4 is present in the Colombian population studied. PMID: 27023435
report association of APOE and TOMM40 with behavioural variant frontotemporal dementia, and ARHGAP35 and SERPINA1 with progressive non-fluent aphasia. PMID: 28387812
Among white women, three single nucleotide polymorphisms (SNPs) (rs2075650 [TOMM40], rs4420638 [APOC1], and rs429358 [APOE]) were significantly associated with survival to 90 years after correction for multiple testing (p < .001); rs4420638 and rs429358 were also significantly associated with healthy aging (p = .02). In African American women, no SNP was associated with longevity. In Hispanic women, 7 SNPs in linkage dise PMID: 27707806
Each epsilon4 allele doubled the risk for AD dementia and the dose effect was evident. Almost identical effect size and effect pattern were observed for TOMM40 '523-L PMID: 28672022
meta-analysis to investigate the association between rs2075650 polymorphism and Alzheimer's disease (AD) in Asian, Caucasian, and mixed populations; analysis shows TOMM40 rs2075650 polymorphism is associated with AD susceptibility in Asian, Caucasian, and mixed populations PMID: 27328316
Results reveal an association of APOE epsilon3/3-TOMM40'523 haplotypes with cognitive decline in community-based older persons such that the S/S poly-T genotype is related to faster cognitive decline, primarily in the domains of episodic and semantic memory. PMID: 28108637
These findings indicated that variants in TOMM40/APOE/APOC1 region might be associated with human longevity. Further studies are needed to identify the causal genetic variants influencing human longevity. PMID: 26657933
Our results do not support the notion that TOMM40 poly-T repeat variants have independent effects on Parkinson's disease with dementia and Dementia with Lewy bodies pathology PMID: 26756745
rs2075650 polymorphism in TOMM40 gene may increase the risk of Alzheimer disease. PMID: 26572157
investigate the influence of the TOMM40 intron 6 poly-T variant (rs10524523) on TOMM40 gene expression and cognitive abilities and decline in a cohort of 1613 community-dwelling elderly volunteers PMID: 26742953
rs2075650 at intron region TOMM40 is associated with the A beta-42 levels in CSF. PMID: 26576771
No significant effects of APOE epsilon or TOMM40 523 genotypes on white matter hyperintensities or cerebral microbleed burden were found amongst 624 participants PMID: 26310205
Epilepsy, impaired fine motor function and gastrostomy tube feeding were less common in cerebral palsy children with single nucleotide polymorphisms in the APOE or TOMM40 genes PMID: 25703783
Its variants are related to impairment in allocentric spatial navigation and reduced cortical thickness of specific brain regions among aMCI individuals with (LOAD neutral) APOE epsilon3/epsilon3 genotype. PMID: 25862420
TOMM40 VL polyT repeat, although not influencing disease susceptibility, has a disease-modifying effect on sIBM, which can be enhanced by the APOE genotype epsilon3/epsilon3. PMID: 25670332
This study show genome-wide significant SNP-based associations within three genomic regions 6q16.1 (MIR2113), 14q12 (AKAP6/NPAS3 region) and 19q13.32 (TOMM40/APOE region) with cognition. PMID: 25644384
Elevated levels of TOMM40 and APOE transcripts found in the brains of late-onset Alzheimer's disease-affected individuals compared with unaffected control brains PMID: 24439168
PVRL2, TOMM40 and APOE might be associated with human longevity. PMID: 24924924
The results of this study suggested that previous findings of an association of the TOMM40 short allele with better cognitive performance, independently from the APOE variant status, are pertinent to elderly with diabetes. PMID: 25044051
Two genetic risk factors for late onset Alzheimer's disease are in the apolipoprotein-e and translocase of outer mitochondrial membrane 40 (TOMM40) gene poly-T repeat loci. PMID: 25247594
Influenza A virus protein PB1-F2 translocates into mitochondria via Tom40 channels and impairs innate immunity. PMID: 25140902
The findings of this study consistently lower TOMM40 expression on longitudinal 2-year sampling support its potential role as a diagnostic blood AD biomarker. PMID: 25201778
The present study shows for the first time that TOMM40 rs157581 polymorphism may modulate regional spontaneous brain activity and related to the progression of amnestic mild cognitive impairment. PMID: 24838536
study did not confirm the impact of rs2075650 on advanced AMD risk, indicating that rs2075650 is unlikely a superior marker for APOE/TOMM40 susceptible region with advanced AMD in Han Chinese population. PMID: 25304313
It was discovered that polymorphic variants of TOMM40 rs741780, rs1160985, and rs8106922 are associated with serum triglyceride concentrations. PMID: 25711031
This study development of depression characterized by reduced extraversion, impaired executive function, and decreased positive emotional recall, and reduced top-down cortical control during sad emotion processing. PMID: 24549102
It is an Alzheimer-disease susceptibility gene. PMID: 24508314
in a large community-dwelling sample of older adults, we found no effects of APOE epsilon or TOMM40 523 genotypes on hippocampal volumes. PMID: 24260406
The results of this study suggested that Polymorphism in the TOMM40 gene modifies the risk of developing sporadic inclusion body myositis and the age of onset of symptoms. PMID: 24103330
Blockade of mitochondrial protein import triggers the recruitment of PARK2, by PINK1, to the TOMM machinery. PMID: 24149440
This study associating theTOMM40rs10524523 genotype with clinical characteristics ofpatients carrying thePSEN1M146L mutation belong-ing to the same kindred. PMID: 23792692
TOMM40 intron 6 poly-T length may explain some of the variation in age at onset in PSEN2 familial mouseclick Alzheimer's disease PMID: 23183136
These data provide no evidence to support an association of rs2075650 in TOMM40 with neovascular age-related macular degeneration or polypoidal choroidal vasculopathy. PMID: 24146538
This study demonstrated that the TOMM40 gene does not have an APOE-independent role in the risk of developing LOAD and FTLD. PMID: 23546992
3 SNPs (rs157580, rs2075650, and rs11556505)were studied in late-onset Alzheimer disease after adjustment for risk factors. Haplotypes derived from SNPs in rs2075650, rs11556505, and rs1160985 were associated with either risk or protective effects. PMID: 23288655
the interaction of alpha-Syn with the mitochondrial protein import machinery, in particular Tom40, might be an upstream event in alpha-Syn-induced neurotoxicity. PMID: 23626796
TOMM40 and APOE common genetic variants are not Parkinson's disease risk factors. PMID: 23522842
TOMM40 gene expression remains significantly lower in Alzheimer's disease patients compared to controls. PMID: 23234877
we report data from two independent Caucasian samples (242 U.S. women and men; 466 Danish men) showing that chronic family stress moderates the association between TOMM40 SNP rs157580 and triglyceride levels. PMID: 23435269
Three SNPs of TOMM40 and APOC1 representating linkage disequilibrium at the 19q13-q13.2 chromosomal region suggest the presence of a different genetic background underlying primary progressive aphasia and the behavioral variant of frontotemporal dementia. PMID: 22710912
Expression levels of TOMM40 protein in mitochondria do not reveal any differences related to the very long or short poly-T variant associated with the risk of late onset Alzheimer's disease. PMID: 22596268
Both TOMM40 and APOE significantly influence age-related memory performance, but they appear to do so independently of each other PMID: 23102119
The results of this study suggested important APOE-independent associations between the TOMM40 '523' polymorphism and specific cognitive domains of memory and executive control that are preferentially affected in early-stage Alzheimer's disease. PMID: 22863908
In chronic hepatitis C, genetic heterogeneity in the APOE/TOMM40 genomic region is significantly associated with variation in serum ApoE and ApoB levels, and also with fibrosis suggesting a pleiotropic attribute of this genomic region. PMID: 22898894

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.