Recombinant Human Mitochondrial Import Receptor Subunit Tom40 Homolog (TOMM40) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-03926P

Greater than 90% as determined by SDS-PAGE.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) TOMM40.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) TOMM40.
Recombinant Human Mitochondrial Import Receptor Subunit Tom40 Homolog (TOMM40) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-03926P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Mitochondrial Import Receptor Subunit Tom40 Homolog (TOMM40) Protein (GST) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | O96008 |
Target Symbol | TOMM40 |
Synonyms | C19orf1; D19S1177E; Haymaker protein; Mitochondrial import receptor subunit TOM40 homolog; Mitochondrial outer membrane protein; Mitochondrial outer membrane protein TOM40; p38.5; PER EC1; PEREC1; Probable mitochondrial import receptor subunit TOM40 homolog; Protein Haymaker; TOM40; TOM40_HUMAN; TOMM40; Translocase of outer membrane 40 kDa subunit homolog; Translocase of outer mitochondrial membrane 40; Translocase of outer mitochondrial membrane 40 homolog (yeast); Translocase of outer mitochondrial membrane 40 homolog; Translocase of outer mitochondrial membrane 40, yeast, homolog of |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | N-GST |
Target Protein Sequence | MGNVLAASSPPAGPPPPPAPALVGLPPPPPSPPGFTLPPLGGSLGAGTSTSRSSERTPGAATASASGAAEDGACGCLPNPGTFEECHRKCKELFPIQMEGVKLTVNKGLSNHFQVNHTVALSTIGESNYHFGVTYVGTKQLSPTEAFPVLVGDMDNSGSLNAQVIHQLGPGLRSKMAIQTQQSKFVNWQVDGEYRGSDFTAAVTLGNPDVLVGSGILVAHYLQSITPCLALGGELVYHRRPGEEGTVMSLAGKYTLNNWLATVTLGQAGMHATYYHKASDQLQVGVEFEASTRMQDTSVSFGYQLDLPKANLLFKGSVDSNWIVGATLEKKLPPLPLTLALGAFLNHRKNKFQCGFGLTIG |
Expression Range | 1-361aa |
Protein Length | Full Length |
Mol. Weight | 64.9kDa |
Research Area | Tags & Cell Markers |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Channel-forming protein essential for import of protein precursors into mitochondria. Plays a role in the assembly of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) by forming a complex with BCAP31 and mediating the translocation of Complex I components from the cytosol to the mitochondria. |
Subcellular Location | Mitochondrion outer membrane; Multi-pass membrane protein. |
Protein Families | Tom40 family |
Database References | HGNC: 18001 OMIM: 608061 KEGG: hsa:10452 STRING: 9606.ENSP00000252487 UniGene: PMID: 28768149 |