Recombinant Human Mitochondrial Import Receptor Subunit Tom34 (TOMM34) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-08866P

Greater than 90% as determined by SDS-PAGE.
Recombinant Human Mitochondrial Import Receptor Subunit Tom34 (TOMM34) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-08866P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Mitochondrial Import Receptor Subunit Tom34 (TOMM34) Protein (GST) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | Q15785 |
Target Symbol | TOMM34 |
Synonyms | hTom34; HTOM34P; Mitochondrial import receptor subunit TOM34; OTTHUMP00000031079; Outer mitochondrial membrane translocase (34kD); TOM 34; TOM34; TOM34_HUMAN; TOMM 34; TOMM34; Translocase of outer membrane 34 kDa subunit; Translocase of outer mitochondrial membrane 34; URCC 3; URCC3 |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | N-GST |
Target Protein Sequence | MAPKFPDSVEELRAAGNESFRNGQYAEASALYGRALRVLQAQGSSDPEEESVLYSNRAACHLKDGNCRDCIKDCTSALALVPFSIKPLLRRASAYEALEKYPMAYVDYKTVLQIDDNVTSAVEGINRMTRALMDSLGPEWRLKLPSIPLVPVSAQKRWNSLPSENHKEMAKSKSKETTATKNRVPSAGDVEKARVLKEEGNELVKKGNHKKAIEKYSESLLCSNLESATYSNRALCYLVLKQYTEAVKDCTEALKLDGKNVKAFYRRAQAHKALKDYKSSFADISNLLQIEPRNGPAQKLRQEVKQNLH |
Expression Range | 1-309aa |
Protein Length | Full Length |
Mol. Weight | 61.6kDa |
Research Area | Signal Transduction |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Plays a role in the import of cytosolically synthesized preproteins into mitochondria. Binds the mature portion of precursor proteins. Interacts with cellular components, and possesses weak ATPase activity. May be a chaperone-like protein that helps to keep newly synthesized precursors in an unfolded import compatible state. |
Subcellular Location | Cytoplasm. Mitochondrion outer membrane; Peripheral membrane protein; Cytoplasmic side. |
Protein Families | Tom34 family |
Database References | HGNC: 15746 OMIM: 616049 KEGG: hsa:10953 STRING: 9606.ENSP00000361900 UniGene: PMID: 26944342 |