Recombinant Human Mitochondrial Import Inner Membrane Translocase Subunit Tim23 (TIMM23) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-08146P

Greater than 90% as determined by SDS-PAGE.
Recombinant Human Mitochondrial Import Inner Membrane Translocase Subunit Tim23 (TIMM23) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-08146P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Mitochondrial Import Inner Membrane Translocase Subunit Tim23 (TIMM23) Protein (GST) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | O14925 |
Target Symbol | TIMM23 |
Synonyms | TIMM23; TIM23; Mitochondrial import inner membrane translocase subunit Tim23 |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | N-GST |
Target Protein Sequence | MEGGGGSGNKTTGGLAGFFGAGGAGYSHADLAGVPLTGMNPLSPYLNVDPRYLVQDTDEFILPTGANKTRGRFELAFFTIGGCCMTGAAFGAMNGLRLGLKETQNMAWSKPRNVQILNMVTRQGALWANTLGSLALLYSAFGVIIEKTRGAEDDLNTVAAGTMTGMLYKCTGGLRGIARGGLTGLTLTSLYALYNNWEHMKGSLLQQSL |
Expression Range | 1-209aa |
Protein Length | Full Length |
Mol. Weight | 48.9kDa |
Research Area | Tags & Cell Markers |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Essential component of the TIM23 complex, a complex that mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane. |
Subcellular Location | Mitochondrion inner membrane; Multi-pass membrane protein. |
Protein Families | Tim17/Tim22/Tim23 family |
Database References | HGNC: 17312 OMIM: 605034 KEGG: hsa:100287932 STRING: 9606.ENSP00000260867 UniGene: PMID: 29413900 |