Recombinant Human Mitochondrial Import Inner Membrane Translocase Subunit Tim16 (PAM16) Protein (GST)

Name: Recombinant Human Mitochondrial Import Inner Membrane Translocase Subunit Tim16 (PAM16) Protein (GST)
Brand: Beta LifeScience
SKU: BLC-10070P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Product Overview

Description	Recombinant Human Mitochondrial Import Inner Membrane Translocase Subunit Tim16 (PAM16) Protein (GST) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	Q9Y3D7
Target Symbol	PAM16
Synonyms	CGI-136; MAGMAS; Magmas like protein; Mitochondria associated protein involved in granulocyte macrophage colony stimulating factor signal transduction; Mitochondria-associated granulocyte macrophage CSF-signaling molecule; Mitochondrial import inner membrane translocase subunit TIM16; PAM16; Presequence translocase-associated motor 16 homolog (S. cerevisiae); Presequence translocated-associated motor subunit PAM16; TIM16; TIM16_HUMAN; TIMM16
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-GST
Target Protein Sequence	MAKYLAQIIVMGVQVVGRAFARALRQEFAASRAAADARGRAGHRSAAASNLSGLSLQEAQQILNVSKLSPEEVQKNYEHLFKVNDKSVGGSFYLQSKVVRAKERLDEELKIQAQEDREKGQMPHT
Expression Range	1-125aa
Protein Length	Full Length
Mol. Weight	40.8kDa
Research Area	Signal Transduction
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Regulates ATP-dependent protein translocation into the mitochondrial matrix. Inhibits DNAJC19 stimulation of HSPA9/Mortalin ATPase activity.
Subcellular Location	Mitochondrion inner membrane; Peripheral membrane protein; Matrix side.
Protein Families	TIM16/PAM16 family
Database References	HGNC: 29679 OMIM: 613320 KEGG: hsa:51025 STRING: 9606.ENSP00000315693 UniGene: Hs.730693
Associated Diseases	Spondylometaphyseal dysplasia, Megarbane-Dagher-Melike type (SMDMDM)
Tissue Specificity	Ubiquitously expressed.

Gene Functions References

A novel essential role of Magmas is a 'ROS regulatory protein' in the maintenance of cellular redox homeostasis and imparting cytoprotection under oxidative stress. PMID: 25165880
finding of deleterious MAGMAS mutations in an early lethal skeletal dysplasia supports a key role for this mitochondrial protein in the ossification process PMID: 24786642
Magmas protects pituitary cells from apoptosis, suggesting its possible involvement in neoplastic transformation. PMID: 20719856
Magmas expression in prostate cancer. PMID: 15704001

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.