Recombinant Human Mitochondrial Import Inner Membrane Translocase Subunit Tim10 B (TIMM10B) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-10305P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Mitochondrial Import Inner Membrane Translocase Subunit Tim10 B (TIMM10B) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-10305P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Mitochondrial Import Inner Membrane Translocase Subunit Tim10 B (TIMM10B) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | Q9Y5J6 |
| Target Symbol | TIMM10B |
| Synonyms | Fracture callus 1 homolog (rat); Fracture callus 1 homolog; Fracture callus protein 1; FxC1; Mitochondrial import inner membrane translocase subunit Tim10 B; Mitochondrial import inner membrane translocase subunit Tim9 B; OTTHUMP00000164584; OTTHUMP00000230720; TIM 10B; Tim10b; Tim9b; TIM9B_HUMAN; TIMM10B; Translocase of inner mitochondrial membrane 10 homolog B (yeast) |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-6His-SUMO |
| Target Protein Sequence | MERQQQQQQQLRNLRDFLLVYNRMTELCFQRCVPSLHHRALDAEEEACLHSCAGKLIHSNHRLMAAYVQLMPALVQRRIADYEAASAVPGVAAEQPGVSPSGS |
| Expression Range | 1-103aa |
| Protein Length | Full Length |
| Mol. Weight | 27.6kDa |
| Research Area | Signal Transduction |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Component of the TIM22 complex, a complex that mediates the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. The TIM22 complex forms a twin-pore translocase that uses the membrane potential as the external driving force. In the TIM22 complex, it may act as a docking point for the soluble 70 kDa complex that guides the target proteins in transit through the aqueous mitochondrial intermembrane space. |
| Subcellular Location | Mitochondrion inner membrane; Peripheral membrane protein. |
| Protein Families | Small Tim family |
| Database References | |
| Tissue Specificity | Ubiquitous, with highest expression in heart, kidney, liver and skeletal muscle. |
