Recombinant Human Mitochondrial Brown Fat Uncoupling Protein 1 (UCP1) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-04477P

Greater than 90% as determined by SDS-PAGE.
Recombinant Human Mitochondrial Brown Fat Uncoupling Protein 1 (UCP1) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-04477P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Mitochondrial Brown Fat Uncoupling Protein 1 (UCP1) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | P25874 |
Target Symbol | UCP1 |
Synonyms | mitochondrial brown fat uncoupling protein; Mitochondrial brown fat uncoupling protein 1; SLC25A7; Solute carrier family 25 member 7; Thermogenin; UCP 1; UCP; UCP1; UCP1_HUMAN; uncoupling protein 1 (mitochondrial, proton carrier); Uncoupling protein 1 |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | N-6His-SUMO |
Target Protein Sequence | GGLTASDVHPTLGVQLFSAGIAACLADVITFPLDTAKVRLQVQGECPTSSVIRYKGVLGTITAVVKTEGRMKLYSGLPAGLQRQISSASLRIGLYDTVQEFLTAGKETAPSLGSKILAGLTTGGVAVFIGQPTEVVKVRLQAQSHLHGIKPRYTGTYNAYRIIATTEGLTGLWKGTTPNLMRSVIINCTELVTYDLMKEAFVKNNILADDVPCHLVSALIAGFCATAMSSPVDVVKTRFINSPPGQYKSVPNCAMKVFTNEGPTAFFKGLVPSFLRLGSWNVIMFVCFEQLKRELSKSRQTMDCAT |
Expression Range | 2-307aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 48.9kDa |
Research Area | Transport |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Mitochondrial protein responsible for thermogenic respiration, a specialized capacity of brown adipose tissue and beige fat that participates in non-shivering adaptive thermogenesis to temperature and diet variations and more generally to the regulation of energy balance. Functions as a long-chain fatty acid/LCFA and proton symporter, simultaneously transporting one LCFA and one proton through the inner mitochondrial membrane. However, LCFAs remaining associated with the transporter via their hydrophobic tails, it results in an apparent transport of protons activated by LCFAs. Thereby, dissipates the mitochondrial proton gradient and converts the energy of substrate oxydation into heat instead of ATP. Regulates the production of reactive oxygen species/ROS by mitochondria. |
Subcellular Location | Mitochondrion inner membrane; Multi-pass membrane protein. |
Protein Families | Mitochondrial carrier (TC 2.A.29) family |
Database References | HGNC: 12517 OMIM: 113730 KEGG: hsa:7350 STRING: 9606.ENSP00000262999 UniGene: PMID: 29796650 |