Recombinant Human Mitochondrial Brown Fat Uncoupling Protein 1 (UCP1) Protein (His)

Name: Recombinant Human Mitochondrial Brown Fat Uncoupling Protein 1 (UCP1) Protein (His)
Brand: Beta LifeScience
SKU: BLC-04182P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins, Recombinant proteins fall special offers - full-length proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Mitochondrial Brown Fat Uncoupling Protein 1 (UCP1) Protein (His) is produced by our Yeast expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P25874
Target Symbol	UCP1
Synonyms	mitochondrial brown fat uncoupling protein; Mitochondrial brown fat uncoupling protein 1; SLC25A7; Solute carrier family 25 member 7; Thermogenin; UCP 1; UCP; UCP1; UCP1_HUMAN; uncoupling protein 1 (mitochondrial, proton carrier); Uncoupling protein 1
Species	Homo sapiens (Human)
Expression System	Yeast
Tag	N-6His
Target Protein Sequence	GGLTASDVHPTLGVQLFSAGIAACLADVITFPLDTAKVRLQVQGECPTSSVIRYKGVLGTITAVVKTEGRMKLYSGLPAGLQRQISSASLRIGLYDTVQEFLTAGKETAPSLGSKILAGLTTGGVAVFIGQPTEVVKVRLQAQSHLHGIKPRYTGTYNAYRIIATTEGLTGLWKGTTPNLMRSVIINCTELVTYDLMKEAFVKNNILADDVPCHLVSALIAGFCATAMSSPVDVVKTRFINSPPGQYKSVPNCAMKVFTNEGPTAFFKGLVPSFLRLGSWNVIMFVCFEQLKRELSKSRQTMDCAT
Expression Range	2-307aa
Protein Length	Full Length of Mature Protein
Mol. Weight	34.9kDa
Research Area	Transport
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Mitochondrial protein responsible for thermogenic respiration, a specialized capacity of brown adipose tissue and beige fat that participates in non-shivering adaptive thermogenesis to temperature and diet variations and more generally to the regulation of energy balance. Functions as a long-chain fatty acid/LCFA and proton symporter, simultaneously transporting one LCFA and one proton through the inner mitochondrial membrane. However, LCFAs remaining associated with the transporter via their hydrophobic tails, it results in an apparent transport of protons activated by LCFAs. Thereby, dissipates the mitochondrial proton gradient and converts the energy of substrate oxydation into heat instead of ATP. Regulates the production of reactive oxygen species/ROS by mitochondria.
Subcellular Location	Mitochondrion inner membrane; Multi-pass membrane protein.
Protein Families	Mitochondrial carrier (TC 2.A.29) family
Database References	HGNC: 12517 OMIM: 113730 KEGG: hsa:7350 STRING: 9606.ENSP00000262999 UniGene: PMID: 29796650 Cellular and genetic evidence supported the regulation of UCP1 transcription by IRX3 as a direct mechanism on the browning program of white adipocytes. PMID: 28988979 Multiple regression analysis showed that age, male gender, body max index, presence of obesity, type-2-diabetes mellitus, hypertension and coronary artery disease and left ventricular ejection fraction were associated with the expression levels of UCP1, PGC1alpha and PRDM16 mRNA PMID: 28824327 Results found a specific fatty acids binding site that is functionally important to the H+ transport activity of UCP1-mediated flux. PMID: 28781081 MKK6 acts as a repressor of UCP1 expression, suggesting that its inhibition promotes adipose tissue browning and increases organismal energy expenditure. PMID: 29021624 determined transcriptional levels of UCP1 and UCP2 in peripheral blood mononuclear cells (PBMCs) from patients with metabolic disorders: type 2 diabetes, obesity and from healthy individuals. PMID: 29151065 We observed that clozapine but not six other antipsychotic drugs reprogrammed the gene expression pattern of differentiating human adipocytes ex vivo, leading to an elevated expression of the browning marker gene UCP1, more and smaller lipid droplets and more mitochondrial DNA than in the untreated white adipocytes. PMID: 27898069 The GG genotype of the UCP1-3826 A/G polymorphism appears to contribute to the onset of childhood obesity in Turkish children. The GG genotype of UCP1, together with the del/del genotype of the UCP2 polymorphism, may increase the risk of obesity with synergistic effects. The ins allele of the UCP2 exon 8 del/ins polymorphism may contribute to low HDL cholesterolemia. PMID: 28704105 TENM2 knockdown induces both UCP1 mRNA and protein expression upon adipogenic differentiation without affecting mitochondrial mass. PMID: 28088466 The role of UCP1 gene polymorphisms A-3826G, A-1766G, Met229Leu and Ala64Thr in susceptibility to obesity or metabolic syndrome was reviewed. PMID: 28100847 Haplotype-based interaction between the PPARGC1A and UCP1 genes is associated with impaired fasting glucose (IFG) or type 2 diabetes mellitus (T2DM) among the residents of Henan province, China. Individuals with the haplotype AAG (PPARGC1A gene) and CTCG (UCP1 gene) have increased susceptibility to IFG or T2DM, while those with haplotype AAG (PPARGC1A gene) and CTCA (UCP1 gene) have a lower risk of IFG or T2DM. PMID: 28591028 human and rodent Brown adipose tissue have similar UCP1 function per mitochondrion. PMID: 27508873 glucocorticoids increased isoprenaline-stimulated respiration and UCP-1 in human primary brown adipocytes. PMID: 27411014 These results reveal different characteristics in the biological actions between WAT and BAT in obese humans. Increased levels of IL6, UCP1 and SIRT1 in the BAT were associated with metabolic parameters improvements. PMID: 28073126 UCP1 dietary activation can alleviate obesity. (Review) PMID: 28057582 The molecular features of UCP1 support a conventional mitochondrial carrier-like mechanism. (Review) PMID: 28057583 The history of discovery of UCP1, the mitochondrial uncoupling protein of brown adipocyte, has been described. (Review) PMID: 27916641 Transcriptional regulation of the UCP1 protein in obesity and normal thermogenesis has been described. (Review) PMID: 27693079 The H+ transport mediated by UCP1 was shown to be electrophoretic with a linear relation to the membrane potential. (Review) PMID: 27794497 In the absence of purine nucleotides, UCP1 presents a high ohmic proton conductance that does not require the presence of activating ligands, such as fatty acids or retinoids. PMID: 27750036 UCP1 is a transporter for H(+) and fatty acid anions. (Review) PMID: 27984203 In inguinal white adipose tissue (iWAT) of mice fed a high-fat diet (HFD), Ucp1 level decreases concomitantly with increases in Cnot7 and its interacting partner Tob. PMID: 26711342 Findings suggest that polymorphisms in SIRT6/UCP1 genes may be important for increased carotid plaque burden and echodensity PMID: 26332421 UCP1 -3826 A>G polymorphism is associated with weight, body fat mass, and risk of type 2 diabetes mellitus in obese individuals candidates for bariatric surgery. PMID: 26458326 UCP1 and UCP3 expression is associated with lipid and carbohydrate oxidation in patients submitted to bariatric surgery. PMID: 26959981 1-3826 A>G polymorphism associated with elevated lipid and apolipoprotein levels in Chinese population PMID: 25928572 this study reveals that human adipose-derived stromal/progenitor cells can be readily differentiated into beige adipocytes that, upon activation, undergo uncoupling protein 1-dependent thermogenesis. PMID: 25389910 This study suggests that the SNP rs1800592 in the UCP1 gene is associated with increased risk of PDR in the Chinese type 2 diabetes mellitus population. PMID: 25274455 Genotype and allele distributions of UCP1, UCP2 and UCP3 polymorphisms did not differ significantly between obese and non-obese Type 2 Diabetes Mellitus patients.[Meta-analysis] PMID: 24752406 Uncoupling protein 1 binds one nucleotide per monomer and is stabilized by tightly bound cardiolipin. PMID: 26038550 Meta-analysis. There was no significant association of the UCP1-3826A/G polymorphism with BMI mean differences. PMID: 24804925 By the application of these findings, we demonstrate that UCP1 is functionally thermogenic in intact brite adipocytes and adrenergic UCP1 activation is largely dependent on adipose triglyceride lipase (ATGL) rather than hormone sensitive lipase (HSL). PMID: 25135951 BMI and TBF were significantly different among UCPI -3826A/G and UCP3 -55C/T genotype combinations, suggesting the existence of a gene interaction between UCP1 and UCP3 in influencing obesity and adiposity in multiethnic Malaysians. PMID: 25812254 MED1 is required for optimal PRDM16-induced Ucp1 expression PMID: 25644605 In obesity, in vitro differentiated beige/brite adipocytes derived from preadipocytes of human subcutaneous white adipose tissues express less UCP1. PMID: 24642703 Human white adipocytes express the cold receptor TRPM8 which activation induces UCP1 expression, mitochondrial activation and heat production. PMID: 24342393 UCP1 -3826A/G and ADRB3 Trp64Arg polymorphisms may have a combined effect in the modulation of overweight/obesity and HDL-C levels in type 2 diabetes mellitus (T2DM) Caucasian-Brazilian patients PMID: 24138564 The season-specific effects of UCP1 on visceral fat area were consistent with a previous finding that active brown adipose tissue was more frequently found in winter than in summer. PMID: 24086366 All-trans-retinoic acid (ATRA) induces UCP1 expression in mouse adipocytes through activation of RARs, whereas expression of UCP1 in human adipocytes is not increased by exposure to ATRA. PMID: 24059847 VDR directly inhibits the expression of uncoupling protein-1 (UCP1). PMID: 23906633 UCP1 -3826 A/G substitution accelerates age-related decrease in BAT activity, and thereby may associate with visceral fat accumulation with age. PMID: 23032405 UCP1 can exist in different functional monomeric and associated states. PMID: 24196960 UCP-1 is relatively abundant in epicardial fat, and this depot possesses molecular features characteristic of those found in vitro in beige lineage adipocytes. PMID: 23824424 Compares and contrasts all the known human SLC25A* genes and includes functional information. PMID: 23266187 High UCP1 expression is associated with pheochromocytoma. PMID: 23454374 UCP-1 single nucleotide polymorphism A-3826G is associated with the dampness-phlegm pattern in Korean stroke patients. PMID: 23043591 The present study demonstrates a sex-specific effect of genetic variants in UCP1 and SIRT3 on cIMT PMID: 22750084 UCP1 in HEK293 cell mitochondria is fully inhibitable and does not contribute to basal proton conductance. PMID: 22676960 These data are consistent with FTO rs9939609 and UCP-1 rs6536991 common variants as contributors to obesity in the Brazilian population. PMID: 23134754 This study links the GG homozygous form of UCP1 with obesity and blood pressure among females only. PMID: 22764640

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.