Recombinant Human Mhc Class I Polypeptide-Related Sequence A (MICA) Protein (hFc), Active
Beta LifeScience
SKU/CAT #: BLC-05604P
Greater than 95% as determined by SDS-PAGE.
Recombinant Human Mhc Class I Polypeptide-Related Sequence A (MICA) Protein (hFc), Active
Beta LifeScience
SKU/CAT #: BLC-05604P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Mhc Class I Polypeptide-Related Sequence A (MICA) Protein (hFc), Active is produced by our Mammalian cell expression system. This is a protein fragment. |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxin | Less than 1.0 EU/μg as determined by LAL method. |
| Activity | The ED50 as determined by its ability to bind Human N2DL2 in functional ELISA is less than 5 ug/ml. |
| Uniprotkb | Q29983 |
| Target Symbol | MICA |
| Synonyms | MHC class I chain-related protein A; MHC class I chain-related protein B; MHC class I polypeptide related sequence A; MHC class I polypeptide related sequence B; MHC class I polypeptide-related sequence A; MIC-A; micA; MICA_HUMAN; MICB |
| Species | Homo sapiens (Human) |
| Expression System | Mammalian cell |
| Tag | C-hFc |
| Complete Sequence | AEPHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETKEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQSHWQ |
| Expression Range | 23-308aa |
| Protein Length | Partial |
| Mol. Weight | 59.9 kDa |
| Research Area | Signal Transduction |
| Form | Lyophilized powder |
| Buffer | Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4 |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Seems to have no role in antigen presentation. Acts as a stress-induced self-antigen that is recognized by gamma delta T-cells. Ligand for the KLRK1/NKG2D receptor. Binding to KLRK1 leads to cell lysis. |
| Subcellular Location | Cell membrane; Single-pass type I membrane protein. Cytoplasm. |
| Protein Families | MHC class I family, MIC subfamily |
| Database References | HGNC: 7090 OMIM: 177900 KEGG: hsa:100507436 UniGene: PMID: 30181474 |
