Recombinant Human Metalloproteinase Inhibitor 4 (TIMP4) Protein (His)

Name: Recombinant Human Metalloproteinase Inhibitor 4 (TIMP4) Protein (His)
Brand: Beta LifeScience
SKU: BLC-08394P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) TIMP4.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Metalloproteinase Inhibitor 4 (TIMP4) Protein (His) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	Q99727
Target Symbol	TIMP4
Synonyms	Metalloproteinase inhibitor 4; TIMP 4; TIMP metallopeptidase inhibitor 4; TIMP-4; Timp4; TIMP4_HUMAN; Tissue inhibitor of metalloproteinase 4; Tissue inhibitor of metalloproteinases 4
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His
Target Protein Sequence	SCAPAHPQQHICHSALVIRAKISSEKVVPASADPADTEKMLRYEIKQIKMFKGFEKVKDVQYIYTPFDSSLCGVKLEANSQKQYLLTGQVLSDGKVFIHLCNYIEPWEDLSLVQRESLNHHYHLNCGCQITTCYTVPCTISAPNECLWTDWLLERKLYGYQAQHYVCMKHVDGTCSWYRGHLPLRKEFVDIVQP
Expression Range	31-224aa
Protein Length	Partial
Mol. Weight	26.3kDa
Research Area	Cardiovascular
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Complexes with metalloproteinases (such as collagenases) and irreversibly inactivates them by binding to their catalytic zinc cofactor. Known to act on MMP-1, MMP-2, MMP-3, MMP-7 and MMP-9.
Subcellular Location	Secreted.
Protein Families	Protease inhibitor I35 (TIMP) family
Database References	HGNC: 11823 OMIM: 601915 KEGG: hsa:7079 STRING: 9606.ENSP00000287814 UniGene: PMID: 28516393 Aspirin-HPR did not affect the translocation and release of MMPs and TIMP-4 from platelets. PMID: 28770228 Combining two biomarkers significantly improved discrimination of AHRE. CONCLUSION: TIMP-4, NT-proANP, NT-proBNP were strongest associated with PAF and AHRE. The discriminatory performance of CHADS2-VASc for PAF was increased by addition of selected biomarkers. PMID: 28431065 Our findings provide new evidence that LOX regulates SNAI2 expression and that SNAI2-mediated TIMP4 secretion plays a role in cancer progression. PMID: 27029493 This report provides the first example that TIMP-4 regulates carcinogenesis through enriching the tumor progenitor cell population in cervical cancer cells. PMID: 26618609 Concluding, miR-200b-3p mediates regulation of TIMP4 expression in prostate cancer but exact mechanism needs to be investigated. PMID: 28028835 regulates carcinogenesis through apoptosis activation in cervical cancer cells PMID: 26291714 Upregulation of plasma TIMP-4 might contribute to PIH [pregnancy-induced hypertension] processes PMID: 25986893 This study provides evidence that the promoter TIMP4 rs3755724 is a new focal epilepsy susceptibility variant that is plausibly involved in inflammation-induced seizures in Malaysian Chinese. PMID: 25595263 Selective myocardial targeting for TIMP-4 induction through either a viral or transgenic approach favorably altered the course of adverse left ventricular remodeling post-myocardial infarction. PMID: 24637197 The rs3755724 in TIMP4 protein was nominally associated with schizophrenia with poor concentration. PMID: 23229788 Heterogeneous methylation in the promoter region of TIMP4 was associated with cancer progression in non-small cell lung cancer. PMID: 22018271 A trend toward increased serum levels of MMP-9/TIMP-4 was found in patients with successful arteriovenous fistulas. PMID: 21620625 Plasma TIMP-4 has a role in the prediction of LV remodeling and the pathophysiology of the heart postinfarction PMID: 21624734 MMP-10 and -7 abundance increased, accompanied by decreased TIMP-4 in dilated cardiomyopathy failing hearts compared with non-failing hearts. PMID: 20219015 TIMP4 expression is a downstream target of GCM1 PMID: 21406447 Expressions of MMP1, MMP9, TIMP4, and EMMPRIN were significantly unbalanced in the myocardium of congestive heart failure patients with rheumatic heart diseases. PMID: 19734590 this work provides the first evidence of a TIMP-4/CD63 association in astrocytoma tumor cells PMID: 20693981 TIMP-4 overexpression is associated with joint tissue remodeling and pathogenesis of osteoarthritic cartilage PMID: 11948685 TIMP-4 is the major intraplatelet matrix metalloproteinase inhibitor and it is involved in regulation of platelet aggregation and recruitment. PMID: 12466243 Progress curve analysis of MMP inhibition by TIMP-4 indicates that association rate constants and inhibition constants are similar to those for other TIMPs; TIMP-4 has a 5-fold lower binding affinity for proMMP-2 than does TIMP-2. PMID: 12475252 Results suggest a functional relationship between TIMP-4 mRNA and MMP-26 mRNA, and possibly a role in human implantation. PMID: 15273280 TIMP-4 displayed negligible activity against TACE, N-TIMP-4 is a slow tight-binding inhibitor with low nanomolar binding affinity PMID: 15713681 TIMP-4 is expressed de novo in cervical cancer PMID: 15816637 In conclusion, the data demonstrate upregulation of TIMP4 in human cardiovascular disorders exhibiting inflammation, suggesting its future use as a novel systemic marker for vascular inflammation. PMID: 16521002 Maximal expression of TIMP-4 in the early and mid-secretory phase suggests its role during implantation and results show that TIMP-4 control the the relaese of MMP-26 in both stroma and uterine fluid. PMID: 16809379 Results indicate that MMP-26 and TIMP-4 may play an integral role during the conversion of high-grade prostatic intraepithelial neoplasia to invasive cancer and may also serve as markers for early prostate cancer diagnosis. PMID: 16940965 Enzyme immunoassays showed the levels of type 4 tissue inhibitor of metalloproteinases were virtually the same in colorectal cancer and mucosa. PMID: 18214300 C/T polymorphism which is located on the 3'-untranslational regions of the TIMP-4 gene might be associated with susceptibility to Osteoarthritis in a Korean population PMID: 18301898 Peroxynitrite-induced nitration and oligomerization of TIMP-4 attenuated its inhibitory activity against MMP-2 activity and endothelial or tumor cell invasiveness. PMID: 18336787 TIMP4 is related to the development of KD with CALs in Korean children. PMID: 19048177 a cardiopulmonary vasculature-specific role of TIMP-4 activation in systemic sclerosis. PMID: 19190762 MMP-3 and TIMP-4 polymorphisms affect angiographic coronary plaque progression in type 2 diabetic and non-diabetic patients PMID: 19376102 TIMP-4 as a simple prognostic marker that may help identify patients with early-stage breast cancer who could benefit from more aggressive treatment at diagnosis PMID: 19700750

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.