Recombinant Human Metalloproteinase Inhibitor 3 (TIMP3) Protein (His)

Name: Recombinant Human Metalloproteinase Inhibitor 3 (TIMP3) Protein (His)
Brand: Beta LifeScience
SKU: BLC-02334P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Metalloproteinase Inhibitor 3 (TIMP3) Protein (His) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P35625
Target Symbol	TIMP3
Synonyms	HSMRK222; K222; K222TA2; Metalloproteinase inhibitor 3; MIG 5 protein; MIG5 protein ; Protein MIG 5; Protein MIG-5; SFD; Sorsby fundus dystrophy pseudoinflammatory; TIMP 3; TIMP metallopeptidase inhibitor 3; TIMP-3; TIMP3; TIMP3_HUMAN; Tissue Inhibitor of Metalloproteinase 3; Tissue inhibitor of metalloproteinases 3; Tissue inhibitor of metalloproteinases3
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His
Target Protein Sequence	HPQDAFCNSDIVIRAKVVGKKLVKEGPFGTLVYTIKQMKMYRGFTKMPHVQYIHTEASESLCGLKLEVNKYQYLLTGRVYDGKMYTGLCNFVERWDQLTLSQRKGLNYRYHLGCNCKIKSCYYLPCFVTSKNECLWTDMLSNFGYPGYQSKHYACIRQKGGYCSWYRGWAPPDKSIINA
Expression Range	30-208aa
Protein Length	Partial
Mol. Weight	24.8kDa
Research Area	Neuroscience
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Complexes with metalloproteinases (such as collagenases) and irreversibly inactivates them by binding to their catalytic zinc cofactor. May form part of a tissue-specific acute response to remodeling stimuli. Known to act on MMP-1, MMP-2, MMP-3, MMP-7, MMP-9, MMP-13, MMP-14 and MMP-15.
Subcellular Location	Secreted, extracellular space, extracellular matrix.
Protein Families	Protease inhibitor I35 (TIMP) family
Database References	HGNC: 11822 OMIM: 136900 KEGG: hsa:7078 STRING: 9606.ENSP00000266085 UniGene: PMID: 29498555 TIMP3 methylation is a marker for TN tumours and furthermore we showed for the first time that TIMP3 promoter methylation is an epigenetic marker of BRCA1ness tumours. PMID: 29524167 As a novel CLOCK-dependent diurnal gene, TIMP3 inhibits the expression of inflammatory cytokines that are up-regulated by UV irradiation in human keratinocytes. PMID: 29180440 miR-21-5p mediates apoptosis by targeting PTEN and TIMP3. PMID: 29393355 Preliminary studies indicate that baseline MMP3 and TIMP3 concentrations are associated with patient survival and disease-free time PMID: 29304854 TIMP-3 mRNA expression levels positively correlates with levels of miR-21 in in situ breast carcinomas and negatively in progesterone receptor positive invasive breast carcinomas. PMID: 28935174 Sphingosine-1-phosphate inhibited cell migration and MMP-2 expression through the upregulation of the tissue inhibitor of metalloproteinase-3 (TIMP-3) expression in human chondrosarcoma cells. PMID: 28672103 Using global proteomic profiling of brain leptomeningeal arteries, this study revealed that clusterin and tissue inhibitor of metalloproteinases-3 increase in leptomeningeal arteries affected by cerebral amyloid angiopathy. PMID: 27543695 This is the first report of a syndromic Sorsby fundus dystrophy in line with the mouse model uncovering the role of TIMP3 in human lung morphogenesis and functions. PMID: 27601084 Collectively, these results demonstrated that IL-32alpha upregulates the atheroprotective genes Timp3 and Reck by downregulating microRNA-205 through regulation of the Rprd2-Dgcr8/Ddx5-Dicer1 biogenesis pathway. PMID: 28740544 MMP-13 may play a role on physiological turnover of cartilage extracellular matrix and that LRP1 is a key modulator of extracellular levels of MMP-13 and its internalization is independent of the levels of ADAMTS-4, -5 and TIMP-3. PMID: 27084377 we show that KDM1A promotes cancer metastasis in non-small cell lung cancer cells by repressing TIMP3 (tissue inhibitor of metalloproteinase 3) expression. PMID: 27058897 Dissecting the interaction between TIMP3 and LRP1 using a synthetic analog of the LRP1 receptor has been reported. PMID: 27476612 These results implicate TIMP3 as a modulator of cell surface GHR abundance and the ability of GH to promote cellular signaling. PMID: 27075707 native glycosaminoglycans interact with TIMP-3. PMID: 27545813 The expression level of LIPC, SLC16A8, and TIMP-3 was significantly associated with age-related macular degeneration pathology. PMID: 27966779 Levels of miR-221/222 are associated negatively with estrogen receptor in in situ tumors and positively with tissue inhibitor of metalloproteinase 3 TIMP3 messenger RNA expression levels in pure invasive breast cancers. PMID: 27488105 Electrostatic potential calculations suggested a competition between negatively charged GAGs and highly negatively charged complement-like domains of LRP-1 for the binding to a positively charged area of TIMP-3 as an underlying mechanism. PMID: 27610455 TIMP3 overexpression after myocardial infarction improves myocardial structural remodeling and function by promoting angiogenesis and inhibiting early proteolysis. PMID: 28550172 Single Nucleotide Variants of Candidate Genes in Aggrecan Metabolic Pathway Are Associated with Lumbar Disc Degeneration and Modic Changes PMID: 28081267 Our data suggest that miR-206 may function as an inflammatory regulator and drive the expression of MMP9 in M.tb-infected THP-1 cells by targeting TIMP3, indicating that miR-206 is a potential therapeutic target for patients with TB. PMID: 27291149 Plasma TIMP3 is a biomarker for predicting the tumor stage in patients with oral squamous cell carcinoma . PMID: 28138307 TIMP-3 K26A/K45A retained higher affinity for sulfated glycosaminoglycans than K42A/K110A and exhibited increased affinity for ADAMTS-5 in the presence of heparin. PMID: 27582494 Of the 225 genetic tests performed, 150 were for recessive IRD, and 75 were for dominant IRD. A positive molecular diagnosis was made in 70 (59%) of probands with recessive IRD and 19 (26%) probands with dominant IRD. Thirty-two novel variants were identified; among these, 17 sequence changes in four genes were predicted to be possibly or probably damaging including: ABCA4 (14), BEST1 (2), PRPH2 (1), and TIMP3 PMID: 28005406 Study evaluated MMP-12 and TIMP-1, TIMP-2, TIMP-3, and TIMP-4 levels in 40 patients with asymptomatic and symptomatic critical carotid artery stenosis (CAS) with neurologic symptoms onset within the preceding 12 hours; results suggest that MMP-12 is related to critical CAS independently on symptoms, moreover, TIMP-3 and TIMP-4 seem to be specifically related to stroke PMID: 27746079 A total of 1096 subjects from eight studies were included in the present meta-analysis. Overall, a significant association between TIMP-3 methylation and gastric cancer risk was observed (OR = 8.65; 95% CI4.31-17.37; p < 0.001). Our results show a positive correlation between TIMP-3 promoter methylation and gastric cancer risk and that TIMP-3 promoter methylation may be used as a molecular marker for gastric cancer PMID: 27314831 TIMP-3 expression is suppressed by promoter methylation in HCC. PMID: 27222429 Both TIMP3 and APC methylation were associated with lymph node metastasis and higher clinical stage of tumors. Patients with methylation at TIMP3 or APC had worse prognoses as compared to those without these alterations. PMID: 27706614 Data indicate the TGF-beta pathway regulates the epithelial-to-mesenchymal transition (EMT) of gastric cancer cells by increasing the levels of microRNA miRNA-181b to target Timp3 via the Smad2/3/4-dependent pathway. PMID: 27383203 Study identifies 2 urinary biomarkers-bFGF and TIMP3-that successfully detect one of the most common pediatric brain tumors, juvenile pilocytic astrocytomas, with high accuracy PMID: 27314542 the levels of TIMP-3, and in some cases also TIMP-2, are decreased in Emery-Dreifuss muscular dystrophy (EDMD). The decrease might be associated with an adverse effect on matrix metalloproteinases and remodelling of the myocardial matrix. The specific decrease of TIMP-3 indicates that this biomarker might help in early detection of cardiac involvement in EDMD. PMID: 25563468 TIMP3 knockdown had opposite effects on the regulation of these genes. PMID: 26749283 This case series suggests the C113G TIMP3 variant may represent a novel highly penetrant mutation causing choroidal neovascularisation of relatively late onset for Sorsby's fundus dystrophy, mimicking early onset AMD. PMID: 26493035 expression of TIMP3 is low in pituitary adenomas including ACTH-secreting pituitary adenomas and negatively associated with tumor aggressiveness. PMID: 26676407 Genotypes of rs135025 and rs80272 in TIMP3 contribute to the development of preeclampsia in Han Chinese women. PMID: 26304100 TIMP3 was validated as a direct target of miRNA-21 by dual-luciferase reporter assay. Silencing with small interfering RNA against TIMP3 promoted angiogenesis and increased MMP2 and MMP9 expression at the protein level. PMID: 26872030 TIMP3 is a dominant negative regulator of angiogenesis in cutaneous melanoma and gene silencing by promoter methylation is associated with poor outcome PMID: 26707830 Taken together, our results suggest that the imbalance between aggrecanase and TIMP-3 may play an important role in the pathogenesis of IDD and therefore be a potential therapeutic target for treating IDD. PMID: 26686417 Gene-gene interactions between Smad3 rs6494629T/C and TIMP3 rs715572G/A polymorphisms may play more important protective roles in knee OA. PMID: 26068512 Results suggest that gene-environment interactions between the TIMP3 rs9862 polymorphisms and betel quid may alter oral cancer susceptibility and tumor growth in Taiwanese men. PMID: 26579821 following acute ACL injury, an upregulation of TIMP-3, the primary aggrecanase inhibitor, is elicited in response to increased aggrecan degradation, which may inhibit further cleavage PMID: 26123869 TIMP3) promotes endothelial apoptosis via a caspase-independent mechanism. PMID: 25558000 This data shows that increased expression of miR-21 enhanced the invasive potential of melanoma cell lines through TIMP3 inhibition. PMID: 25587717 The miR-191-TIMP3 axis might be critical in the malignant transformation of endometriosis to endometriosis-associated ovarian cancer. PMID: 25819812 TIMP-3 expression was associated with malignant behaviors of hepatocellular carcinoma, including portal vein invasion and lymph node metastasis. TIMP-3 expression was an independent prognostic factor for disease-free survival and overall survival PMID: 25171061 TIMP3 methylation had prognostic value in patients with glioblastoma multiforme. PMID: 25467143 This study expands the spectrum of mutations in the TIMP3 gene and associated phenotypic findings. Imaging using late-phase ICG-A may be useful for early identification of individuals at risk for developing SFD. PMID: 25766588 The hypermethylation frequencies of TIMP-3 and GSTP-1 of reversible chronic inflammatory gum disease and the control group were similar, but both were significantly lower than those for malignant disease patients. PMID: 25041782 HPV-positive oropharyngeal squamous cell carcinoma is associated with TIMP3 and CADM1 promoter hypermethylation. PMID: 25065733 Report no association of TIMP3 genetic polymorphisms with thoracic aortic dissection in Chinese Han population. PMID: 24487965

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.