Recombinant Human Melanoma-Associated Antigen B2 (MAGEB2) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-07668P

Greater than 85% as determined by SDS-PAGE.
Recombinant Human Melanoma-Associated Antigen B2 (MAGEB2) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-07668P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Melanoma-Associated Antigen B2 (MAGEB2) Protein (His&Myc) is produced by our Mammalian cell expression system. This is a full length protein. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | O15479 |
Target Symbol | MAGEB2 |
Synonyms | Cancer/testis antigen 3.2 (CT3.2) (DSS-AHC critical interval MAGE superfamily 6) (DAM6) (MAGE XP-2 antigen) (MAGE-B2 antigen) |
Species | Homo sapiens (Human) |
Expression System | Mammalian cell |
Tag | N-10His&C-Myc |
Target Protein Sequence | MPRGQKSKLRAREKRRKARDETRGLNVPQVTEAEEEEAPCCSSSVSGGAASSSPAAGIPQEPQRAPTTAAAAAAGVSSTKSKKGAKSHQGEKNASSSQASTSTKSPSEDPLTRKSGSLVQFLLYKYKIKKSVTKGEMLKIVGKRFREHFPEILKKASEGLSVVFGLELNKVNPNGHTYTFIDKVDLTDEESLLSSWDFPRRKLLMPLLGVIFLNGNSATEEEIWEFLNMLGVYDGEEHSVFGEPWKLITKDLVQEKYLEYKQVPSSDPPRFQFLWGPRAYAETSKMKVLEFLAKVNGTTPCAFPTHYEEALKDEEKAGV |
Expression Range | 1-319aa |
Protein Length | Full Length |
Mol. Weight | 40.3 kDa |
Research Area | Cancer |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | May enhance ubiquitin ligase activity of RING-type zinc finger-containing E3 ubiquitin-protein ligases. Proposed to act through recruitment and/or stabilization of the Ubl-conjugating enzyme (E2) at the E3:substrate complex. |
Database References | |
Tissue Specificity | Expressed in testis and placenta, and in a significant fraction of tumors of various histologic types. |
Gene Functions References
- MAGEB2 can be aberrantly demethylated and expressed in malignant peripheral nerve sheath tumors. Conversely, the gene may not be demethylated in any types of neurofibroma, suggesting that the demethylation does not occur before malignant transformation. PMID: 26642794
- MageB2 counteracts E2F inhibition by ribosomal proteins independently of Mdm2 expression PMID: 26468294
- we identified MAGEB2 as activated by promoter demethylation in HNSCCand demonstrates growth promoting effects in a minimally transformed oral keratinocyte cell line. PMID: 23029077
- Valproic acid causes a change in acetylation of this gene. PMID: 17012225