Recombinant Human Matrix Metalloproteinase-9 (MMP9) Protein (His)

Name: Recombinant Human Matrix Metalloproteinase-9 (MMP9) Protein (His)
Brand: Beta LifeScience
SKU: BLC-10883P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, Antibody / cell therapy targets, Antibody therapeutic / adc target proteins, Explore high-quality enzymes for research and supplementation, Featured enzyme molecules, High-quality recombinant proteins, Protease

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Matrix Metalloproteinase-9 (MMP9) Protein (His) is produced by our Yeast expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P14780
Target Symbol	MMP9
Synonyms	82 kDa matrix metalloproteinase-9; 92 kDa gelatinase; 92 kDa type IV collagenase; CLG 4B; CLG4B; Collagenase Type 4 beta; Collagenase type IV 92 KD; EC 3.4.24.35; Gelatinase 92 KD; Gelatinase B; Gelatinase beta; GelatinaseB; GELB; Macrophage gelatinase; MANDP2; Matrix metallopeptidase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase); Matrix Metalloproteinase 9; MMP 9; MMP-9; MMP9; MMP9_HUMAN; Type V collagenase
Species	Homo sapiens (Human)
Expression System	Yeast
Tag	N-6His
Target Protein Sequence	FQTFEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTRFGNADGAACHFPFIFEGRSYSACTTDGRSDGLPWCSTTANYDTDDRFGFCPSERLYTQDGNADGKPCQFPFIFQGQSYSACTTDGRSDGYRWCATTANYDRDKLFGFCPTRADSTVMGGNSAGELCVFPFTFLGKEYSTCTSEGRGDGRLWCATTSNFDSDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMYPMYRFTEGPPLHKDDVNGIRHLYGPRPEPEPRPPTTTTPQPTAPPTVCPTGPPTVHPSERPTAGPTGPPSAGPTGPPTAGPSTATTVPLSPVDDACNVNIFDAIAEIGNQLYLFKDGKYWRFSEGRGSRPQGPFLIADKWPALPRKLDSVFEERLSKKLFFFSGRQVWVYTGASVLGPRRLDKLGLGADVAQVTGALRSGRGKMLLFSGRRLWRFDVKAQMVDPRSASEVDRMFPGVPLDTHDVFQYREKAYFCQDRFYWRVSSRSELNQVDQVGYVTYDILQCPED
Expression Range	107-707aa
Protein Length	Partial
Mol. Weight	68.6kDa
Research Area	Developmental Biology
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Matrix metalloproteinase that plays an essential role in local proteolysis of the extracellular matrix and in leukocyte migration. Could play a role in bone osteoclastic resorption. Cleaves KiSS1 at a Gly-\|-Leu bond. Cleaves NINJ1 to generate the Secreted ninjurin-1 form. Cleaves type IV and type V collagen into large C-terminal three quarter fragments and shorter N-terminal one quarter fragments. Degrades fibronectin but not laminin or Pz-peptide.
Subcellular Location	Secreted, extracellular space, extracellular matrix.
Protein Families	Peptidase M10A family
Database References	HGNC: 7176 OMIM: 120361 KEGG: hsa:4318 STRING: 9606.ENSP00000361405 UniGene: PMID: 30226602 Our findings indicate that monitoring serum MMP-9 and detection of histological MMP-9 could help identify TNBC patients who will respond to NAC and will display varying risks of disease relapse. MMP-9 may serve as a predictive and prognostic biomarker for tailoring and modifying the NAC strategy for TNBC. PMID: 30241470 significantly increased in the serum of type 2 diabetes mellitus patients with diabetic retinopathy PMID: 29752166 Study evaluated for the first time the plasma levels and the diagnostic usefulness of VEGF, MMP-9, and TIMP-1 in cervical cancer (CC), not only independently but especially in combination with established cervical tumor markers. All tested parameters showed statistical significance when compared their concentrations in patients with CC to healthy women. PMID: 30037277 In monocytes, incubation with psoriasis' sera increased the production of MMP-9 and TIMP-1 in comparison with both baseline and monocytes incubated with non-psoriatic sera PMID: 29979898 High mmp9 expression is associated with Endometrial adenocarcinoma. PMID: 30139240 There was studied the level of matrix metalloproteinase-9 (MMP-9) in plasma of bone marrow aspirates in 87 patients: 39 with acute myeloid leukemia (AML) and 48 myelodysplastic syndrome (MDS). It has been found out an association of the level of MMP-9 in plasma of bone marrow aspirates in patients with AML and MDS with a volume of leukemic mass. PMID: 30444586 This study provides the first evidence for the involvement of polymorphisms within MMP9 and the severity of childhood trauma in antipsychotic treatment response PMID: 29448178 HOXD-AS1 was upregulated in non-small cell lung carcinoma tissues and cell lines and promoted NSCLC cell proliferation, migration invasion via sponging miR-133b and regulating MMP9. PMID: 29958139 rs3918241, rs2250889, rs17576 and rs17577 polymorphisms of MMP-9 are not associated with altered risk of urinary cancer. PMID: 30249503 PARP-1, via manipulating the binding of NF-kB/AP-1 at the MMP-9 promoter, regulates MMP-9 expression, which helps maintain mitochondrial homeostasis. PMID: 28478229 The results suggest that the MMP9 gene may affect genetic predisposition to tick-borne encephalitis in a Russian population. PMID: 29496490 MMP-9 was targeted by hsa-miR-494, which inhibited OS. PMID: 29068478 In placenta, a significant positive correlation between MMP-9 and gestational age was noted in the first trimester. When gestational age was controlled for, partial correlation revealed a significant positive correlation between TNF-alpha and MMP-9 only in the second trimester. PMID: 28820024 Melatonin inhibits epithelialtomesenchymal transition in gastric cancer cells via attenuation of IL1beta/NFkappaB/MMP2/MMP9 signaling. PMID: 30066836 Data indicate that CD147 promotes breast cancer cell proliferation, metastasis, and invasion by modulating matrix metalloproteinase 9 (MMP-9) and vascular endothelial growth factor (VEGF) expression. PMID: 29901696 immune system process is indispensable in the progression of disease in colon, and identifies that IL-8 and MMP-9 play potential critical roles for the progression. PMID: 30074183 The demethylation of the MMP-9 gene promoter region may be involved in the occurrence and development of diabetic nephropathy by regulating the expression of MMP-9 protein in serum. PMID: 29952417 Patients carrying the variant T allele of the MMP9 rs3918242 polymorphism exhibited significantly higher infarct volumes than those with the major CC genotype. PMID: 30257242 Increased matrix metalloproteinase-9/tissue inhibitor of metalloproteinase-1 ratio in smokers with airway hyperresponsiveness is associated with accelerated lung function decline. PMID: 29692608 MMP-9 and TIMP-1 levels are correlated with age, pathological grade, tumor size and lymph node metastasis of breast cancer patients. PMID: 30010105 When ANXA5 expression increased, cell proliferation was inhibited by regulating the expression of bcl-2 and bax while cell metastasis was suppressed by regulating E-cadherin and MMP-9 expression. PMID: 30010106 IL-33 can regulate deposition of ECM and promote the process of pulmonary fibrosis by inducing the imbalance between MMP-9 and TIMP-1. PMID: 29417309 Results show that MMP9 specifically binds to H3K27me1 nucleosomes allowing the cleavage of H3N-terminal tail. PMID: 29807539 Study shows that rs1056629 polymorphism in the 3'UTR of MMP9 disrupts its binding to miR-491 in pressure ulcer (PU)patients after hip fracture. mRNA and protein expression levels are high in PU specimens. PMID: 29620239 No association between the carriage of studied MMP9 polymorphisms and the predisposition to preeclampsia was found. PMID: 29670668 the logistic regression analysis, none of the genes was associated with AOB (anterior open bite). In conclusion, the polymorphism rs17576 (glutamine for arginine substitution) in MMP9 was a protective factor for AOB PMID: 29297546 Results provide evidence that MMP9 plays critical roles in mesenchymal stem cells high suppressive potency, which also involves the capacity to induce and integrated multiple immunoregulatory mechanisms. PMID: 28408751 piperine reduced the expression of pAkt, MMP9 and pmTOR. Together, these data indicated that piperine may serve as a promising novel therapeutic agent to better overcome prostate cancer metastasis. PMID: 29488612 Our study demonstrated that both positive expression status in tumor tissue and expression levels of MMP-9 are significantly elevated in BC patients and correlate with disease progression. Thus, MMP-9 can serve as a biomarker to determine the degree of BC malignancy. PMID: 29578150 Our findings indicate that overexpression of MMP-9 rescued insulin survival signaling in vitro and in early stages in the 5XFAD model of AD. PMID: 28386117 Review/Meta-analysis: Matrix metalloproteinase-9 has high predictive value for hemorrhagic transformation after acute ischemic stroke. PMID: 29598905 The expression of MMP-9 is associated with clinical outcome in chondrosarcoma. PMID: 29316907 MMP-9 levels in the tumor tissue extracts had also increased significantly PMID: 29520667 MMP-9 -1562 C/T polymorphism might be related to the digestive cancer susceptibility [meta-analysis] PMID: 29890308 MMP-9 protein overexpression was found in prostate cancers, low expression in any of the normal tissues or in benign prostatic tissue PMID: 27355218 Hypoxia promotes retinoblastoma cell line HXO-RB44 invasion by activating HIF-1alpha/MMP9 signaling pathway. PMID: 29243776 Authors conclude that ADAM8 promotes early metastatic processes such as transendothelial migration by upregulation of MMP-9 and shedding of PSGL-1 from breast cancer cells. PMID: 28986926 High expression of MMP-9 and TLR4 in patients with COPD may promote inflammatory cell infiltration, induce proliferation of smooth muscle cells, degrade extracellular matrix, and play an important role in lung revascularization. PMID: 28537664 The data obtained from this study show that mild hypothermia therapy down regulated the expression of MMP-9 mRNA, the MMP-9 protein level and increased the FOUR score and GCS in high-risk TBI patients within 72 h. PMID: 28966304 High MMP9 expression is associated with cervical cancer. PMID: 30052166 MMP-9 overexpression and activation are important events occurring during oral squamous cell carcinoma progression/invasion and that this overexpression/activation is regulated by c-Myc, active MMP-2 and inactive GSK3beta mediated pathways. PMID: 29134466 Plasma concentration of MMP9 demonstrated no associations with stroke occurrence in a West African cohort. PMID: 29074065 High mmp9 expression is associated with ovarian cancer cell migration and invasion. PMID: 28677781 no significant difference was detected in the expression level of individual MMP9 and TIMP1 genes in SCZ patients versus healthy controls either in total numbers of subject or in sex based subgroups PMID: 28578515 Data suggest that MIR129 or MIR335 overexpression in keratinocytes inhibits MMP9 promoter activity and protein expression by targeting SP1; inhibition of these microRNAs has the opposite effect. These mechanisms may be involved in regulation of wound healing. (MIR = microRNA; MMP9 = matrix metalloproteinase-9; SP1 = transcription factor-SP1) PMID: 29748291 Significant association observed for MMP-9 (-1562C/T) (OR 1.27; 95% CI 1.06 to 1.53) gene polymorphism and risk of ischemic stroke. [meta-analysis] PMID: 29906531 MMP-9 activity increases postpartum. Women experiencing uncomplicated vaginal delivery demonstrate higher postpartum MMP-9 activity and are more likely to have recovered their vaginal angle. PMID: 29155140 Results show that MMP9 degrades MMRN2 allowing endothelial cells migration and sprouting angiogenesis. PMID: 28435016 The findings suggest that AEG-1 promotes gastric cancer metastasis through upregulation of eIF4E-mediated MMP-9 and Twist. PMID: 28661037

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

📧 inquiry@betalifesci.com 📞 +1(201) 888-7983

Contact Us Now for Inquiries, Orders, and Questions

Recombinant Human Matrix Metalloproteinase-9 (MMP9) Protein (His)

Recombinant Human Matrix Metalloproteinase-9 (MMP9) Protein (His)

Product Overview

Target Details

FAQs