Recombinant Human Maternal Embryonic Leucine Zipper Kinase (MELK) Protein (His&Myc)

Name: Recombinant Human Maternal Embryonic Leucine Zipper Kinase (MELK) Protein (His&Myc)
Brand: Beta LifeScience
SKU: BLC-01611P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Maternal Embryonic Leucine Zipper Kinase (MELK) Protein (His&Myc) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	Q14680
Target Symbol	MELK
Synonyms	Maternal embryonic leucine zipper kinase (EC:2.7.11.1);hMELK;Protein kinase Eg3;pEg3 kinase;Protein kinase PK38;hPK38;Tyrosine-protein kinase MELK
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-10His&C-Myc
Target Protein Sequence	MKDYDELLKYYELHETIGTGGFAKVKLACHILTGEMVAIKIMDKNTLGSDLPRIKTEIEALKNLRHQHICQLYHVLETANKIFMVLEYCPGGELFDYIISQDRLSEEETRVVFRQIVSAVAYVHSQGYAHRDLKPENLLFDEYHKLKLIDFGLCAKPKGNKDYHLQTCCGSLAYAAPELIQGKSYLGSEADVWSMGILLYVLMCGFLPFDDDNVMALYKKIMRGKYDVPKWLSPSSILLLQQMLQVDPKKRISMKNLLNHPWIMQDYNYPVEWQSKNPFIHLDDDCVTELSVHHRNNRQTMEDLISLWQYDHLTATYLLLLAKKARGKPVRLRLSSFSCG
Expression Range	1-340aa
Protein Length	Partial
Mol. Weight	44.3 kDa
Research Area	Cell Biology
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Serine/threonine-protein kinase involved in various processes such as cell cycle regulation, self-renewal of stem cells, apoptosis and splicing regulation. Has a broad substrate specificity; phosphorylates BCL2L14, CDC25B, MAP3K5/ASK1 and ZNF622. Acts as an activator of apoptosis by phosphorylating and activating MAP3K5/ASK1. Acts as a regulator of cell cycle, notably by mediating phosphorylation of CDC25B, promoting localization of CDC25B to the centrosome and the spindle poles during mitosis. Plays a key role in cell proliferation and carcinogenesis. Required for proliferation of embryonic and postnatal multipotent neural progenitors. Phosphorylates and inhibits BCL2L14, possibly leading to affect mammary carcinogenesis by mediating inhibition of the pro-apoptotic function of BCL2L14. Also involved in the inhibition of spliceosome assembly during mitosis by phosphorylating ZNF622, thereby contributing to its redirection to the nucleus. May also play a role in primitive hematopoiesis.
Subcellular Location	Cell membrane; Peripheral membrane protein.
Protein Families	Protein kinase superfamily, CAMK Ser/Thr protein kinase family, SNF1 subfamily
Database References	HGNC: 16870 OMIM: 607025 KEGG: hsa:9833 STRING: 9606.ENSP00000298048 UniGene: PMID: 28536141 In common culture conditions, the authors found that small molecule inhibition, genetic deletion, or acute depletion of MELK did not significantly affect cellular growth. PMID: 28926338 Synthesis of MCL1, an antiapoptotic protein known to play a role in cancer cell survival during cell division, depends on the function of MELK-elF4B signaling. PMID: 27528663 Inhibition of MELK (genetically and pharmacologically) induces radiation sensitivity. PMID: 27225691 MELK is a host factor required for optimal uncoating of the HIV-1 core to promote viral cDNA synthesis. PMID: 28683086 Here, the authors report that mutagenizing MELK with CRISPR/Cas9 has no effect on the fitness of basal breast cancer cell lines or cell lines from six other cancer types. Cells that harbor null mutations in MELK exhibit wild-type doubling times, cytokinesis, and anchorage-independent growth. PMID: 28337968 MELK-inhibitor has a role in triple-negative breast cancer cells demonstrating context-dependent response with p53 as a key determinant PMID: 28235006 MELK is an oncogenic kinase involved in the pathogenesis and recurrence of hepatocellular carcinoma. PMID: 27693640 Inhibition or depletion of MELK reduced cell proliferation and anchorage-dependent and -independent growth in various ovarian cancer cell lines through a G2/M cell cycle arrest, eventually resulting in apoptosis. PMID: 28214016 Report IL11RA and MELK amplification in gastric cancer cell lines and primary gastric adenocarcinomas. PMID: 27920471 MELK expression in hepatocellular carcinoma is extremely intense compared to its expression reported in other types of cancer and could be a promising effective tumor marker of HCC. PMID: 27798878 targeting MELK by the inhibition of both its catalytic activity and its protein stability might sensitize tumours to DNA-damaging agents or radiation therapy by lowering the DNA-damage threshold PMID: 26431963 Together, these data indicate that MELK is a normally non-essential kinase, but is critical for basal-like breast cancer. PMID: 24844244 EZH2 protects glioma stem cells from radiation-induced cell death in a MELK/FOXM1-dependent manner PMID: 25601206 we report characterization of possible roles of MELK in acute myeloid leukemia PMID: 25365263 insight has been brought by the discovery of a protein complex of FOXM1 with the mitotic kinase MELK in cancer stem cells in brain cancers, as this protein complex appears to be cancer-specific PMID: 25017123 advanced cancers with OTSSP167 started in 2013, as the first-in-class MELK inhibitor. This review summarizes the current molecular understanding of MELK and the recent preclinical studies about MELK as a cancer therapeutic target. PMID: 24795222 MELK promotes cell migration and invasion via the FAK/Paxillin pathway, and plays an important role in the occurrence and development of gastric cancer. PMID: 24885567 our current knowledge of MELK function and recent discoveries in MELK signaling pathway were discussed. PMID: 24185907 The structural and biochemical analyses unravel the molecular mechanisms for the autophosphorylation/activation of MELK and the dependence of its catalytic activity on reducing agents. PMID: 23922895 Report MELK inhibitor that suppresses the growth of a wide range of human tumor cell lines. PMID: 23283305 Data indicate that expression-based risk indices of three genes UBE2C, TPX2, and MELK were more strongly associated with poor 5-year survival in adenocarcinoma patients. PMID: 23357462 MELK is upregulated in high-grade prostate cancer PMID: 22945237 MELK could be associated with increased resistance of colorectal cancer cells against radiation and 5-FU. PMID: 21806965 High MELK is associated with brain tumor. PMID: 21558073 MELK expression is increased in breast cancer tissue and this is associated with poor survival. The most important factors controlling Bcl-G activity are post-translational modification by Fau & MELK. PMID: 19671159 pEg3 is a potential regulator of the G2/M progression and may act antagonistically to the CDC25B phosphatase,pEg3 kinase is able to specifically phosphorylate CDC25B in vitro. One phosphorylation site was identified and corresponded to serine 323 PMID: 12400006 analysis of MELK substrate specificity and activity regulation PMID: 16216881 the kinase activity of MELK is likely to affect mammary carcinogenesis through inhibition of the pro-apoptotic function of Bcl-GL PMID: 17280616 a critical role for MELK in the proliferation of brain tumors, including their stem cells, and suggest that MELK may be a compelling molecular target for treatment of high-grade brain tumors. PMID: 17722061 Maternal embryonic leucine zipper kinase transcript abundance correlates with malignancy grade in astrocytomas PMID: 17960622

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.