Recombinant Human Mannose-Binding Protein C (MBL2) Protein (His)

Name: Recombinant Human Mannose-Binding Protein C (MBL2) Protein (His)
Brand: Beta LifeScience
SKU: BLC-10897P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Mannose-Binding Protein C (MBL2) Protein (His) is produced by our Yeast expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P11226
Target Symbol	MBL2
Synonyms	COLEC 1; COLEC1; Collectin-1; HSMBPC; Lectin; mannose-binding; soluble; 2; Mannan binding lectin; Mannan binding protein; Mannan-binding protein; Mannose binding lectin (protein C) 2 soluble; Mannose binding lectin (protein C) 2; soluble (opsonic defect); Mannose binding lectin (protein C) 2; soluble; Mannose binding lectin 2 soluble; Mannose binding lectin 2; soluble (opsonic defect); Mannose binding lectin; Mannose binding lectin protein C2 soluble opsonic defect; Mannose binding protein; Mannose binding protein C; Mannose binding protein C precursor ; Mannose binding protein; serum; Mannose-binding lectin; Mannose-binding protein C; MBL 2; MBL; MBL2; MBL2_HUMAN; MBL2D; MBP 1; MBP; MBP C; MBP-C; MBP1; MBPB; MBPC; MBPD; MGC116832; MGC116833; Opsonic defect; protein C; Soluble mannose binding lectin
Species	Homo sapiens (Human)
Expression System	Yeast
Tag	N-6His
Target Protein Sequence	ETVTCEDAQKTCPAVIACSSPGINGFPGKDGRDGTKGEKGEPGQGLRGLQGPPGKLGPPGNPGPSGSPGPKGQKGDPGKSPDGDSSLAASERKALQTEMARIKKWLTFSLGKQVGNKFFLTNGEIMTFEKVKALCVKFQASVATPRNAAENGAIQNLIKEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKNGQWNDVPCSTSHLAVCEFPI
Expression Range	21-248aa
Protein Length	Full Length of Mature Protein
Mol. Weight	26.0kDa
Research Area	Immunology
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Calcium-dependent lectin involved in innate immune defense. Binds mannose, fucose and N-acetylglucosamine on different microorganisms and activates the lectin complement pathway. Binds to late apoptotic cells, as well as to apoptotic blebs and to necrotic cells, but not to early apoptotic cells, facilitating their uptake by macrophages. May bind DNA.
Subcellular Location	Secreted.
Database References	HGNC: 6922 OMIM: 154545 KEGG: hsa:4153 STRING: 9606.ENSP00000363079 UniGene: PMID: 30015228 he carrying of MBL2 exon 1 codon 54 variant allele (B) was shown to be a risk factor for Recurrent vulvovaginal candidiasis in childbearing women. PMID: 29850562 Positive correlation of MBL levels with anti-ds DNA titers in systemic lupus erythematosus suggest that its values vary with activity and could be a potential biomarker of the disease. PMID: 29314753 The -221G>C polymorphism of MBL2, the -159C>T polymorphism of CD14 and the TNF-857 polymorphism of TNF-a are risk factors for spinal spinal tuberculosis (TB) and may be involved in the development of spinal TB in the Chinese population. These factors are indicators of susceptibility to spinal TB and require clinical attention. PMID: 29298876 MBL2 protein blood level was significantly reduced in the hepatocellular carcinoma patients.The association in MBL2 polymorphisms and the risk of hepatocellular carcinoma. PMID: 27557564 Results suggested the involvement of MBL2 (rs1800450) polymorphism and its protein in rheumatic heart disease pathogenesis. PMID: 29653582 MBL deficiency was significantly more frequent in the juvenile idiopathic arthritis Yersinia-reactive antibodies-positive group than in patients without Yersinia-reactive antibodies or in controls PMID: 28405017 it can be concluded that molecular analysis of MBL rs1800450 AA genotype and TNF-alpha rs1800620 AA genotype is important in the early detection and treatment of T2DM with H. pylori cagA(+) infection. PMID: 29053425 The results suggest that MBL deficiency and the presence of MBL2 gene polymorphisms that lead to MBL deficiency are risk factors for the occurrence of miscarriage in patients with RA. PMID: 28898115 These results suggest that the MBL2 gene Codon 54 and TNF-alpha gene G308A polymorphisms are not associated with an increased risk for development of tuberculosis in our patients. PMID: 28189510 Studies results provide evidence that Crohn's disease patients have an impairment in mannose-binding lectin-mannose-associated serine protease functional activity and that this defect is associated with mannose-binding lectin 2 and NOD2 variants. PMID: 27404661 Our data do not support a possible role for MBL2 polymorphisms in the pathogenesis and in the clinical manifestations of rheumatic fever. PMID: 28576308 The reduced expression of functional MBL secondary to having MBL2 variants may partially mediate the increased susceptibility to TB risk. PMID: 27812036 MBL2 rs1800450 and rs1800451 polymorphisms play a protective role in TB infection and reinforce their critical significance as a potential genetic marker for TB resistance. PMID: 27876780 genetic variants facilitate extended periodontal inflammation and destruction by Aggregatibacter actinomycetemcomitans PMID: 27624657 MBL2 exon 1 polymorphic variants were found only in codon 54, and the allele frequencies did not differ significantly between the control and disease groups PMID: 28558668 These results indicated that polymorphisms in MBL2 gene may influence susceptibility, progression and prognosis of HBV-related liver diseases. PMID: 26857650 The article data indicate that rs11003125 in the MBL2 (Mannose Binding Lectin 2) gene was shown to be associated with a high prevalence of caries in our cohort, and 2 haplotypes are also involved in the increased susceptibility to dental caries. PMID: 27894112 the findings of the current study obtained on mother and children from Zambia evidence lack of association between MBL2 functional polymorphisms and HIV-1 mother-to-child transmission PMID: 26740328 Mannose-binding lectin levels are largely genetically determined. This relationship was preserved in children during critical illness, despite the effect of large-volume fluid administration on mannose-binding lectin levels. Mannose-binding lectin levels had no association with infection status at admission, or with progression from systemic inflammatory response syndrome to sepsis or septic shock. PMID: 27820718 Low MBL levels are associated with a higher risk for future cardiac events and cardiovascular events. PMID: 27495980 results showed that despite MBL2 gene polymorphisms being associated with the protein plasma levels, the polymorphisms were not enough to predict the development of heart disease, regardless of infection with both species of Chlamydia. PMID: 27982280 MBL2 polymorphisms are associated with higher incidence of development of coronary in-stent restenosis. PMID: 28056798 MBL2 gene exon1 polymorphisms are associated with increased risk of high-risk HPV infection and cervical cancer development among Caucasians (Meta-Analysis) PMID: 27619685 these data support the concept that rhMBL may serve a protective innate host response and a critical biological response modifier function by limiting AM inflammation, oxidative injury, and AM apoptosis, which may allow effective IAV clearance while limiting collateral damage to vital organs, such as the lungs. PMID: 24399838 In a large cohort of VLBWI MBL2 deficiency had no major impact on infection risk unless children were born between 32 0/7 and 36 6/7 weeks of gestation PMID: 28558032 The results suggest that the mutations in exon 1 of the MBL2 gene do not contribute directly to the clinical and laboratory features of HCV and HBV infections, but further studies should be performed to confirm whether the wild AA genotype has indirect effect on disease progression. PMID: 28408790 binding of dengue virus NS1 to MBL protects dengue virus against mannose-binding lectin-mediated neutralization by the lectin pathway of complement activation PMID: 27798151 study provides evidence for an important role for the lectin pathway in the inflammatory response induced by cholesterol crystals (CC) and emphasize the role of ficolin-2 and MBL in the CC-mediated inflammation occurring during atherosclerotic plaque development PMID: 27183610 In our meta-analysis, no significant association was found between MBL2 codon 54 A/B, -550 H/L, or -221 X/Y gene polymorphisms and the risk of asthma under 5 genetic models PMID: 27590640 MBL2 genotype association with meningococcal disease was not statistically significant. PMID: 27351742 The SNP genotypes of MBL2 influence the plasma levels of MBL. However, there is a wide range in MBL levels for a specific genotype of MBL2 during pregnancy indicating that a low second-trimester plasma MBL level is not a marker for the development of preterm birth. PMID: 27124763 We have identified two single-nucleotide polymorphisms in two immune-related genes (MBL2 and CD95) that have an association with severe and potentially life-threatening infection following doxorubicin and cyclophosphamide therapy for breast cancer. PMID: 27940354 this study shows that collectin may aid clearance of influenza A virus by promoting monocyte uptake of the virus, while reducing viral replication and virus-induced TNF-a responses in these cells PMID: 27856789 findings suggest that complement activation mediated by MBL contributes to the pathogenesis and also severity of Multiple sclerosis, Myasthenia gravis, and Guillain-Barre Syndrome . PMID: 27424141 Studied the relationship between polymorphisms in MBL, TLR1, TLR2 and TLR6 encoding genes and stimulated IFN-gamma and IL-12 ex vivo production in BCG osteitis survivors. Found that variant genotypes of the MBL2 gene (if homozygous) and variant genotypes of the TLR2 gene (only heterozygotes present) are associated with low IFN-gamma production. PMID: 27755461 this study shows that MBL2 polymorphisms is not a major risk factor for community-acquired pneumonia in general, but patients with genotypes corresponding with high serum MBL levels are at risk for atypical pneumonia PMID: 28032346 MBL-deficient individuals with additional lectin pathway pattern recognition molecular defects may be at risk to morbidity. PMID: 26795763 MBL2 polymorphisms were associated with an increased and TLR7 polymorphisms with a decreased risk of rhinovirus-associated acute otitis media. PMID: 28403045 MBL2 rs11003123 polymorphism may be a marker for the risk of hepatocellular carcinoma occurrence in patients with HBV-related cirrhosis in the Chinese population. PMID: 27298104 this study shows that MBL levels may be linked with the occurrence of spondyloarthritis in Brazilian patients PMID: 27911110 Low baseline MBL levels were correlated with high risk of gram-negative bacteremia; however, no significant correlation was shown in the follow-up. PMID: 26377840 These results indicate that the mycobacterial antigen 85 complex is a target for ficolins and mannose-binding lectin. PMID: 27141819 In type 1 diabetic patient, evaluated serum levels of MBL can be seen as an independent marker of diabetic nephropathy even after correcting for possible confounding factors. PMID: 26212019 association between C + 4T (P/Q) gene polymorphism and oropharyngeal tularemia PMID: 27223255 this study shoes that Brazilian patients carrying genotypes or haplotypes of low production of MBL would be more susceptible to dengue haemorrhagic fever PMID: 27180198 Low MBL serum levels and deficient MBL2 diplotypes were associated with a higher incidence of acute cellular rejection during the first year after kidney transplantation. PMID: 26924055 this study shows the role of MBL2 polymorphisms in hepatitis C infection susceptibility in Italy PMID: 27136459 Preterm infants who had low levels of MBL at admission are exposed to an increased risk of adverse neurological outcomes. PMID: 26153116 Variant A allele in MBL2 gene rs1800450 polymorphism might increase the risk of sepsis via decrease the MBL serum level PMID: 26823854

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

📧 inquiry@betalifesci.com 📞 +1(201) 888-7983

Contact Us Now for Inquiries, Orders, and Questions

Recombinant Human Mannose-Binding Protein C (MBL2) Protein (His)

Recombinant Human Mannose-Binding Protein C (MBL2) Protein (His)

Product Overview

Target Details

FAQs