Recombinant Human Mammaglobin-A (SCGB2A2) Protein (His&Myc)

Beta LifeScience SKU/CAT #: BLC-11019P

Recombinant Human Mammaglobin-A (SCGB2A2) Protein (His&Myc)

Beta LifeScience SKU/CAT #: BLC-11019P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human Mammaglobin-A (SCGB2A2) Protein (His&Myc) is produced by our E.coli expression system. This is a full length protein.
Purity Greater than 85% as determined by SDS-PAGE.
Uniprotkb Q13296
Target Symbol SCGB2A2
Synonyms Mammaglobin 1; Mammaglobin-1; Mammaglobin-A; MGB1; Scgb2a2; Secretoglobin family 2A member 2; SG2A2; SG2A2_HUMAN; UGB2
Species Homo sapiens (Human)
Expression System E.coli
Tag N-10His&C-Myc
Target Protein Sequence GSGCPLLENVISKTINPQVSKTEYKELLQEFIDDNATTNAIDELKECFLNQTDETLSNVEVFMQLIYDSSLCDLF
Expression Range 19-93aa
Protein Length Full Length of Mature Protein
Mol. Weight 15.9 kDa
Research Area Tags & Cell Markers
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Subcellular Location Secreted.
Protein Families Secretoglobin family, Lipophilin subfamily
Database References

HGNC: 7050

OMIM: 605562

KEGG: hsa:4250

STRING: 9606.ENSP00000227918

UniGene: PMID: 26207726

  • good coincidence was observed between primary and metastatic tumor GATA3 expression (kappa value = 0.826 >0.75) as compared with the coincidence of GCDFP15 (kappa value =0.492 <0.75) and mammaglobin (kappa value =0.593 <0.75) PMID: 28038704
  • Expression of MGB1 was higher in breast cancer than non-malignant tissue and it decreased during breast cancer progression. PMID: 27563000
  • trefoil factor 1 demonstrated breast specificity but was inferior to mammaglobin and GATA protein binding 3 PMID: 26276775
  • Mammaglobin-A immunohistochemistry in primary central nervous system neoplasms and intracranial metastatic breast carcinoma. Cimino PJ Jr, Perrin RJ PMID: 23958549
  • Overexpression of hMAM in breast cancer cells decreased migration and invasion, whereas knockdown of hMAM increased both. PMID: 24328556
  • Mammaglobin immunohistochemistry is useful as a proxy marker for the ETV6-NTRK3 translocation in the diagnosis of salivary mammary analogue secretory carcinoma. PMID: 23773480
  • High peripheral blood mammaglobin gene expression is associated with metastasis in breast cancer. PMID: 22897908
  • Gross cystic disease fluid protein-15 and mammaglobin A expression determined by immunohistochemistry is of limited utility in triple-negative breast cancer. PMID: 22963676
  • MGB1 was detected in endometrial tissue, with peak expression during the luteal phase, in 31% of endometriotic samples, in 53% of endometrial adenocarcinomas, and in 64% of breast carcinomas. PMID: 22994369
  • Qualitative detection of plasma hMAM mRNA appears to be associated with unfavorable prognostic factors and lower rates of event-free survival in patients with breast cancer. PMID: 23212340
  • Data show that HLA-A24-restricted, mammaglobin-A (Mam-A) derived, CD8(+) cytotoxic T lymphocyte (CTL) epitopes that can potentially be employed for Mam-A-based breast cancer vaccine therapy to breast cancer patients with HLA-A24 phenotype. PMID: 22074997
  • A decrease in MGB1+mRNA levels (baseline-week 8) seemed to be associated with clinical response (P = 0.05). PMID: 21976532
  • MGA detection by the modified nested RT-PCR is a specific marker for circulating tumor cells in patients with breast carcinoma and a negative prognostic factor for the disease PMID: 21939647
  • High serum mammaglobin is associated with breast cancer. PMID: 21744998
  • The current knowledge regarding the use of reverse-transcriptase PCR for detecting human mammaglobin mRNA as a biomarker for circulating tumor cells in breast cancer patients, is reviewed. PMID: 21473729
  • The expression of hMAG was found to be increased with breast cancer grade. PMID: 21623075
  • Most basal-like breast carcinomas and unclassified triple-negative carcinomas are negative for mammaglobin and gross cystic disease fluid protein 15. PMID: 21411781
  • Detection of Mammaglobin as part of a 3-marker RT-PCR for early diagnosis of breast cancer. PMID: 20586026
  • detection of mammaglobin mRNA is useful to determine the effect of therapy while maspin transcripts may indicate more aggressive disease. PMID: 20092039
  • Expression of MGB1 transcript is associated with breast cancer PMID: 14696125
  • MGB1 markers may be useful for identifying micrometastases in sentinel lymph nodes of breast cancer patients. PMID: 15151203
  • Mammaglobin has a role in progression of breast cancer, as shown by its expression in leukapheresis products PMID: 15447988
  • MGA protein exists in 2 main forms in breast neoplasms PMID: 15609337
  • occult blood hMAM mRNA can be detected by RT-PCR and may have a role in progression of breast neoplasms PMID: 16110760
  • mammaglobin expression is associated with expression of estrogen receptor and progesteron receptor in metastasizing breast cancer [letter] PMID: 16203799
  • MGB1 transcript in peripheral blood of breast cancer patients was specific but with low sensitivity. MGB1 overexpression by itself or in combination with Ki67 might be considered an index of breast cancer rogression PMID: 16760290
  • mammaglobin mRNA is expressed in breast cancer tissue PMID: 16761620
  • Mammaglobin A is a highly specific molecular marker for the detection of circulating tumor cells in operable breast cancer, with important prognostic applications. PMID: 16925986
  • MGB1 immunohistochemistry can serve as a differential marker of breast cancer metastasis from primary lung cancer. PMID: 17192791
  • successfully generated MGB-specific CD4 T cell cultures and identified candidate MGB HLA class II epitopes PMID: 17653857
  • The sensitivity of mammaglobin is equal or superior to that of GCDFP-15 for investigation of breast carcinoma. PMID: 18251583
  • mammaglobin mRNA in peripheral blood may have a role in progression of breast cancer PMID: 18289390
  • RT-PCR for hMAM test was more sensitive than cytomorphology of breast cancer derived pleural effusion. PMID: 18303409
  • The overexpression of mammaglobin observed in certain breast tumors is an epiphenomenon not causally involved in breast carcinogenesis. PMID: 18630503
  • This study demonstrated that human mammaglobin transcripts are expressed in the CSF of a BC patient with LM carcinomatosis. PMID: 18841443
  • Breast cancer patients with pre-operative elevated bone marrow levels of Mammaglobin Aand/or trefoil factor 1 mRNA seem to constitute a small group of patients with a very poor prognosis. PMID: 18846421
  • Both MGB1 and GCDFP-15 are specific markers for metastatic breast carcinomas in cell block fluid specimens (88 vs. 96%). PMID: 19217055
  • Mammaglobin is a sensitive marker of breast carcinoma, it defines a subgroup of patients with better prognosis and is a useful method to detect breast cancer metastases. PMID: 19690758
  • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    Recently viewed