Recombinant Human Macrophage Migration Inhibitory Factor (MIF) Protein (His&Myc)
Recombinant Human Macrophage Migration Inhibitory Factor (MIF) Protein (His&Myc)
Collections: All products, Antibody / cell therapy targets, Antibody therapeutic / adc target proteins, Buy cytokines, chemokines, and growth factors for research online, Christmas & new year research sale — 30% off storewide, Growth factors and receptors for advanced research, High-quality cytokines for advanced research, High-quality recombinant proteins, In-stock recombinant proteins
Submit an inquiry or email sales for a custom bulk quote. Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
| Description | Recombinant Human Macrophage Migration Inhibitory Factor (MIF) Protein (His&Myc) is produced by our Baculovirus expression system. This is a full length protein. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | P14174 |
| Target Symbol | MIF |
| Synonyms | GIF; GLIF; Glycosylation inhibiting factor; Glycosylation-inhibiting factor; L-dopachrome isomerase; L-dopachrome tautomerase; Macrophage migration inhibitory factor (glycosylation-inhibiting factor); Macrophage migration inhibitory factor; MIF; MIF protein; MIF_HUMAN; MMIF; Phenylpyruvate tautomerase |
| Species | Homo sapiens (Human) |
| Expression System | Baculovirus |
| Tag | N-10His&C-Myc |
| Target Protein Sequence | PMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA |
| Expression Range | 2-115aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 16.2 |
| Research Area | Immunology |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Pro-inflammatory cytokine. Involved in the innate immune response to bacterial pathogens. The expression of MIF at sites of inflammation suggests a role as mediator in regulating the function of macrophages in host defense. Counteracts the anti-inflammatory activity of glucocorticoids. Has phenylpyruvate tautomerase and dopachrome tautomerase activity (in vitro), but the physiological substrate is not known. It is not clear whether the tautomerase activity has any physiological relevance, and whether it is important for cytokine activity. |
| Subcellular Location | Secreted. Cytoplasm. |
| Protein Families | MIF family |
| Database References |
HGNC: 7097 OMIM: 153620 KEGG: hsa:4282 STRING: 9606.ENSP00000215754 UniGene: PMID: 30226561 |
