Recombinant Human Macrophage Colony-Stimulating Factor 1 (CSF1) Protein (His)

Name: Recombinant Human Macrophage Colony-Stimulating Factor 1 (CSF1) Protein (His)
Brand: Beta LifeScience
SKU: BLC-05003P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, Antibody / cell therapy targets, Antibody therapeutic / adc target proteins, Buy cytokines, chemokines, and growth factors for research online, Colony-stimulating factors and receptors (csfs), Growth factors and receptors for advanced research, High-quality cytokines for advanced research, High-quality recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Macrophage Colony-Stimulating Factor 1 (CSF1) Protein (His) is produced by our Yeast expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P09603
Target Symbol	CSF1
Synonyms	Colony stimulating factor 1 (macrophage); Colony stimulating factor 1; Colony stimulating factor macrophage specific; CSF 1; CSF-1; CSF1; CSF1_HUMAN; Csfm; Lanimostim; M CSF; M-CSF; Macrophage Colony Stimulating Factor 1; Macrophage colony stimulating factor; MCSF; MGC31930; Processed macrophage colony-stimulating factor 1
Species	Homo sapiens (Human)
Expression System	Yeast
Tag	C-6His
Target Protein Sequence	EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQDVVTKPDCN
Expression Range	33-190aa
Protein Length	Partial
Mol. Weight	19.9
Research Area	Cardiovascular
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Cytokine that plays an essential role in the regulation of survival, proliferation and differentiation of hematopoietic precursor cells, especially mononuclear phagocytes, such as macrophages and monocytes. Promotes the release of proinflammatory chemokines, and thereby plays an important role in innate immunity and in inflammatory processes. Plays an important role in the regulation of osteoclast proliferation and differentiation, the regulation of bone resorption, and is required for normal bone development. Required for normal male and female fertility. Promotes reorganization of the actin cytoskeleton, regulates formation of membrane ruffles, cell adhesion and cell migration. Plays a role in lipoprotein clearance.
Subcellular Location	Cell membrane; Single-pass type I membrane protein.; [Processed macrophage colony-stimulating factor 1]: Secreted, extracellular space.
Database References	HGNC: 2432 OMIM: 120420 KEGG: hsa:1435 STRING: 9606.ENSP00000327513 UniGene: PMID: 29422647 Data showed that single expression of M-CSF or IL-34 can be observed in lung cancer tissues and correlated with poor survival. Additionally, their high co-expression correlates with disease stages and poor survival. Thus, evaluating the expression of both M-CSF and IL-34 may help to estimate disease progression and malignant degree in lung cancer patients. PMID: 29323162 The functional rs2050462 in CSF-1 might have a substantial influence on the renal cell carcinoma susceptibility and evolution in the Chinese population. PMID: 29734839 Study find elevated expression of CSF1 in primary gastric cancer tissue (GC) to be significantly associated with the presence of lymph node and peritoneal metastasis, advanced TNM stage, and poor survival. In vitro analysis also revealed a functional role for the CSF1 in GC development, and a prognostic and predictive biomarker for GC. PMID: 29767252 Results suggest that monocytes from Crohn's disease patients in remission produced high levels of CSF-1 that upregulate CCR5 expression. Consequently, monocytes differentiated in these conditions had a characteristic phenotype and lower production of inflammatory cytokines. PMID: 28273887 High M-CSF expression is associated with cervical cancer. PMID: 30052166 Concerning pigmented villonodular synovitis , clinical trials assessing CSF-1R inhibitors have revealed promising initial outcomes. Blocking CSF-1/CSF-1R signaling represents a promising immunotherapy approach and several new potential combination therapies for future clinical testing. PMID: 28875266 It was demonstrated that MCSF and folliclestimulating hormone stimulated the production of estradiol (E2) in luteinized granulosa cells. MCSF may be important in regulating the response of luteinized granulosa cells to gonadotropin and may have a promotive effect in the early phase of follicular development. PMID: 28656272 miR-1207-5p and CSF1 expression levels and their relationship with lung cancer survival and metastasis status were assayed by means of a lung cancer tissue microarray. PMID: 27107415 Upregulation of GM-CSF and M-CSF production by endothelial cells, an effect that appears to be mediated by NF-kappaB and to be independent of IL-1, may be an additional mechanism through which IL-33 contributes to inflammatory activation of the vessel wall. PMID: 27173404 High CSF-1 expression is associated with Breast Cancer. PMID: 28687620 Nucleolin both forms an mRNP complex with the eIF4G and CSF-1 mRNA, and is co-localized with the eIF4G in the cytoplasm further supporting nucleolin's role in translational regulation. PMID: 28131007 study, therefore, provided insights into the sequence-structure-function relationships of the M-CSF/c-FMS interaction and of ligand/receptor tyrosine kinase interactions in general. PMID: 28655719 Therefore, our findings indicate that CSF1 signaling is oncogenic during gliomagenesis through a mechanism distinct from modulating glioma-associated microglia/macrophage polarization status PMID: 27013192 High CSF1 expression is associated with breast cancer. PMID: 27599777 M-CSF has been shown to be comparable to CA15-3 and VEGF, specificity, and AUC values only in stages III and IV of BC. PMID: 27445439 M-CSF macrophage conversion into foam cells reduces their proinflammatory responses to classical M1-polarizing activation PMID: 27038418 This can be achieved by either blocking the EGF or CSF-1 receptors or supressing the EGF or CSF-1 signal. PMID: 26686751 findings demonstrated that M-CSF binds to IL-34; molecular docking studies predicted the formation of a heteromeric M-CSF/IL-34 cytokine PMID: 26095744 RGC-32 expression on M2-polarized and tumor-associated macrophages is M-CSF-dependent and enhanced by tumor-derived IL-4. PMID: 25418473 Data show crystal structures of CSF1-CSF1R ternary complexes, and propose a mechanism for their cooperative action that relies on the adoption by dimeric CSF-1 of an active conformational state and homotypic receptor interactions. PMID: 26235028 In patients with CLE, 100 and 150 mg PD-0360324 (monoclonal antibody against MCSF) every 2 weeks for 3 months suppressed a subset of circulating monocytes. PMID: 26376111 peripheral nerve injury induced de novo expression of colony-stimulating factor 1 (CSF1) in injured sensory neurons. CSF1 was transported to the spinal cord, where it targeted the microglial CSF1 receptor (CSF1R). PMID: 26642091 These findings highlight an essential role for PRKAA1-mediated autophagy during differentiation of human monocytes. PMID: 26029847 These findings suggest a high usefulness of M-CSF in diagnosing the serous sub-type of epithelial ovarian cancer and in discriminating between cancer and non-carcinoma lesions PMID: 25935153 expression and release, from osteoblasts of macrophage colony-stimulating factor (M-CSF), which is indispensable for osteoclast differentiation, was inhibited by uPAR loss. PMID: 25196912 By identifying the M-CSFM residues critical for M-CSF-c-FMS interactions, we have laid down the basis for a deeper understanding of the M-CSF . c-FMS signaling mechanism PMID: 26359491 Colony Stimulating Factors 1, 2, 3 and early pregnancy PMID: 25721620 study shows up-regulation of MCSF in GBM via a SYK-PI3K-NFkappaB-dependent mechanism and identifies IGFBP1 released by microglial cells as a novel mediator of MCSF-induced angiogenesis PMID: 26245897 macrophage colony-stimulating factor (M-CSF) may be involved in the regulation of epiphyseal plate injury and repair in Kashin-Beck disease. PMID: 25138985 Determination of CSF1 and CSF1R expression may be useful as a prognosticator of the clinical course and/or outcomes of Pigmented villonodular synovitis . PMID: 25854167 Our findings also suggest that next generation sequencing may help explore the pathogenesis and aid the diagnosis of Juvenile Paget's disease. PMID: 25891874 results presented herein suggest a potential cross-talk between cancer cells and the microenvironment controlled by CSF1/Vav1 signaling pathways. PMID: 25313137 None of SNPs among rs333967, rs2297706 and rs1058885 in CSF-1 was found statistically significantly associated with CP in Han Chinese with Shanghai origin. haplotype T-C-G showed statistically significant association with decreased risk in males. PMID: 24592910 The aim of the present study was to assess the effect of soluble mediators produced by breast cancer cells on human osteoclast maturation in a co-culture model. PMID: 24956020 FoxO1 is highly expressed in M-CSF-derived (M2-like) macrophage subsets, and this M2-like macrophages showed a preferential FoxO1 enrichment on the IL-10 promoter but not in GM-CSF-derived (M1-like) macrophages PMID: 25420919 potent profibrotic factor in hepatitis C virus liver fibrosis PMID: 25066464 Findings suggest the replacement of the 3'-UTR of CSF1 with other sequences in tenosynovial giant cell tumors. PMID: 24604026 In a cohort of 453 human breast tumors, NCOA1 and CSF1 levels correlated positively with disease recurrence, higher tumor grade, and poor prognosis. PMID: 24769444 high expression correlates with shorter metastasis-free survival in non-small-cell lung cancer patients PMID: 23870818 genetic polymorphism is associated with platelet counts PMID: 24178511 The findings of this study regarding the unique functional interplay between M-CSF and IL-32 increase our understanding of the mechanisms that regulate the survival and M1/M2 ratio of macrophages, as well as HIV-1 replication in macrophages. PMID: 24748497 Elevated CSF1 serum level is associated with early breast cancer. PMID: 24016870 This study is the first to illustrate downstream transcriptional profiles and pathways of IL-34 in comparison with CSF-1 and identify notable differences in CCR2 expression. PMID: 23684409 Regulation of immediate-early gene response by THOC5, a member of mRNA export complex contributes to the M-CSF-induced macrophage differentiation. PMID: 24157873 Nucleolin mediates microRNA-directed CSF-1 mRNA deadenylation but increases translation of CSF-1 mRNA. PMID: 23471483 The results indicate usefulness of VEGF and M-CSF in diagnostics of breast cancer patients, especially in combination with CA 15-3. PMID: 23688065 GPNMB expression was regulated by EpCAM and CSF-1 partly through their common downstream product c-myc PMID: 23924854 The expression of CSF2 (but not CSF1) was highly up-regulated in glioblastoma patients and we found an inverse correlation between CSF2 expression and patient survival. PMID: 23520016 the feline CSF-1R was cloned and the responsiveness to CSF-1 and IL-34 from a range of species, was examined. PMID: 23260168

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

📧 inquiry@betalifesci.com 📞 +1(201) 888-7983

Contact Us Now for Inquiries, Orders, and Questions

Recombinant Human Macrophage Colony-Stimulating Factor 1 (CSF1) Protein (His)

Recombinant Human Macrophage Colony-Stimulating Factor 1 (CSF1) Protein (His)

Product Overview

Target Details

FAQs