Recombinant Human M7Gpppn-Mrna Hydrolase (DCP2) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-04526P

Greater than 90% as determined by SDS-PAGE.
Recombinant Human M7Gpppn-Mrna Hydrolase (DCP2) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-04526P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human M7Gpppn-Mrna Hydrolase (DCP2) Protein (His) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | Q8IU60 |
Target Symbol | DCP2 |
Synonyms | DCP2; DCP2 decapping enzyme homolog (S. cerevisiae); DCP2, S. cerevisiae, homolog of; DCP2_HUMAN; decapping enzyme 2, S. cerevisiae, homolog of; decapping enzyme homolog (S. cerevisiae); FLJ33245; hDpc; m7GpppN-mRNA hydrolase; mRNA decapping enzyme 2; mRNA-decapping enzyme 2; Nucleoside diphosphate-linked moiety X motif 20; nudix (nucleoside diphosphate linked moiety X)-type motif 20; Nudix motif 20; NUDT20 |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | N-6His |
Target Protein Sequence | METKRVEIPGSVLDDLCSRFILHIPSEERDNAIRVCFQIELAHWFYLDFYMQNTPGLPQCGIRDFAKAVFSHCPFLLPQGEDVEKVLDEWKEYKMGVPTYGAIILDETLENVLLVQGYLAKSGWGFPKGKVNKEEAPHDCAAREVFEETGFDIKDYICKDDYIELRINDQLARLYIIPGIPKDTKFNPKTRREIRNIEWFSIEKLPCHRNDMTPKSKLGLAPNKFFMAIPFIRPLRDWLSRRFGDSSDSDNGFSSTGSTPAKPTVEKLSRTKFRHSQQLFPDGSPGDQWVKHRQPLQQKPYNNHSEMSDLLKGKKCEKKLHPRKLQDNFETDAVYDLPSSSEDQLLEHAEGQPVACNGHCKFPFSSRAFLSFKFDHNAIMKILDL |
Expression Range | 1-385aa |
Protein Length | Full Length of Isoform 2 |
Mol. Weight | 48.4kDa |
Research Area | Transcription |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Decapping metalloenzyme that catalyzes the cleavage of the cap structure on mRNAs. Removes the 7-methyl guanine cap structure from mRNA molecules, yielding a 5'-phosphorylated mRNA fragment and 7m-GDP. Necessary for the degradation of mRNAs, both in normal mRNA turnover and in nonsense-mediated mRNA decay. Plays a role in replication-dependent histone mRNA degradation. Has higher activity towards mRNAs that lack a poly(A) tail. Has no activity towards a cap structure lacking an RNA moiety. The presence of a N(6)-methyladenosine methylation at the second transcribed position of mRNAs (N(6),2'-O-dimethyladenosine cap; m6A(m)) provides resistance to DCP2-mediated decapping. Blocks autophagy in nutrient-rich conditions by repressing the expression of ATG-related genes through degradation of their transcripts. |
Subcellular Location | Cytoplasm, P-body. Nucleus. |
Protein Families | Nudix hydrolase family, DCP2 subfamily |
Database References | HGNC: 24452 OMIM: 609844 KEGG: hsa:167227 STRING: 9606.ENSP00000373715 UniGene: PMID: 25870104 |