Recombinant Human M-Phase Inducer Phosphatase 3 (CDC25C) Protein (His)

Name: Recombinant Human M-Phase Inducer Phosphatase 3 (CDC25C) Protein (His)
Brand: Beta LifeScience
SKU: BLC-03641P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: High-quality recombinant proteins, Other recombinant proteins, Recombinant proteins fall special offers - full-length proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human M-Phase Inducer Phosphatase 3 (CDC25C) Protein (His) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P30307
Target Symbol	CDC25C
Synonyms	CDC 25; Cdc 25C; CDC25; CDC25C; Cell division cycle 25 homolog C; Cell division cycle 25C; Cell division cycle 25C protein; Dual specificity phosphatase Cdc25C; M phase inducer phosphatase 3; M-phase inducer phosphatase 3; Mitosis inducer CDC25; MPIP3; MPIP3_HUMAN; Phosphotyrosine phosphatase; PPP1R60; protein phosphatase 1, regulatory subunit 60
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His
Target Protein Sequence	MSTELFSSTREEGSSGSGPSFRSNQRKMLNLLLERDTSFTVCPDVPRTPVGKFLGDSANLSILSGGTPKRCLDLSNLSSGEITATQLTTSADLDETGHLDSSGLQEVHLAGMNHDQHLMKCSPAQLLCSTPNGLDRGHRKRDAMCSSSANKENDNGNLVDSEMKYLGSPITTVPKLDKNPNLGEDQAEEISDELMEFSLKDQEAKVSRSGLYRSPSMPENLNRPRLKQVEKFKDNTIPDKVKKKYFSGQGKLRKGLCLKKTVSLCDITITQMLEEDSNQGHLIGDFSKVCALPTVSGKHQDLKYVNPETVAALLSGKFQGLIEKFYVIDCRYPYEYLGGHIQGALNLYSQEELFNFFLKKPIVPLDTQKRIIIVFHCEFSSERGPRMCRCLREEDRSLNQYPALYYPELYILKGGYRDFFPEYMELCEPQSYCPMHHQDHKTELLRCRSQSKVQEGERQLREQIALLVKDMSP
Expression Range	1-473aa
Protein Length	Full Length
Mol. Weight	57.4kDa
Research Area	Cell Biology
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Functions as a dosage-dependent inducer in mitotic control. Tyrosine protein phosphatase required for progression of the cell cycle. When phosphorylated, highly effective in activating G2 cells into prophase. Directly dephosphorylates CDK1 and activates its kinase activity.
Subcellular Location	Nucleus.
Protein Families	MPI phosphatase family
Database References	HGNC: 1727 OMIM: 157680 KEGG: hsa:995 STRING: 9606.ENSP00000321656 UniGene: PMID: 30097580 FHL1 increase inhibitory CDC25 phosphorylation by forming a complex with CHK2 and CDC25, and sequester CDC25 in the cytoplasm by forming another complex with 14-3-3 and CDC25, resulting in increased radioresistance in cancer cells. PMID: 28094252 CDC25A plays a novel role in regulating the malignant behavior of glioma stem cells as a part of Linc00152/miR-103a-3p/FEZF1/CDC25A axis. PMID: 28651608 Overexpression of the CDK1 and CDC25A may have a role in the pathogenesis of the NFPA. PMID: 28004354 Mdm2 overexpression and Cdc25C downregulation delay cell cycle progression through the G2/M phase. PMID: 28806397 Xanthatin functions as a DNA-damaging agent in non-small cell lung carcinomas by activating Chk1-mediated DDR and lysosome-mediated degradation of Cdc25C. PMID: 29074359 Myelodysplastic syndrome -related P95 point mutants of SRSF2 lead to alternative splicing of CDC25C in a manner that is not dependent on the DNA damage response. PMID: 27552991 The aim of this review is to shed light on the role of four different phosphatases (PTEN, PP2A, CDC25 and DUSP1) in five different solid tumors (breast cancer, lung cancer, pancreatic cancer, prostate cancer and ovarian cancer), in order to better understand the most frequent and aggressive primary cancer of the central nervous system, glioblastoma. PMID: 28801478 Data show that TRIB2-mediated degradation of CDC25C is associated with lysine-48-linked CDC25C polyubiquitination driven by the TRIB2 kinase-like domain. PMID: 27563873 High expression of pCHK2-Thr68 was associated with decreased patient survival (p = 0.001), but was not an independent prognostic factor. Our results suggest that pCHK2-Thr68 and pCDC25C-Ser216 play important roles in breast cancer and may be potential treatment targets PMID: 27801830 the biology of the activation/deactivation of CDC25 by kinases/phosphatases to maintain the level of CDK-cyclin activities and thus the genomic stability PMID: 27038604 the knockdown of CDC25C can reduce both the radiotherapy sensitivity and the proliferation activity of EC9706 cells. PMID: 27188256 results identify CDC25C as a downstream target of the mutated tyrosine kinase FLT3-ITD affecting cell-cycle regulation in a model of AML PMID: 27919943 Suggest that the p53-p21-DREAM-CDE/CHR pathway regulates p53-dependent repression of Survivin, CDC25C, and PLK1 in HCT116 cells. PMID: 26595675 These miR-142-3p functioned as a tumor suppressor by targeting CDC25C. PMID: 26805039 Cdc25C negatively regulates proapoptotic ASK1 in a cell cycle-dependent manner and may play a role in G2/M checkpoint-mediated apoptosis. PMID: 25633196 Recurrent CDC25C mutations drive malignant transformation in familial platelet disorder to acute myelogenous leukaemia. PMID: 25159113 we conclude that inhibition of KIF22 suppresses cancer cell proliferation by delaying mitotic exit through the transcriptional upregulation of CDC25C. PMID: 24626146 These findings indicate that DHM inhibits the growth of hepatocellular carcinoma (HCC) cells via G2/M phase cell cycle arrest through Chk1/Chk2/Cdc25C pathway PMID: 24002546 Purification and biochemical analysis of catalytically active human cdc25C dual specificity phosphatase PMID: 23567337 protein plays a role in regulating PCa cell growth, and androgen treatments, but not EGF, greatly increase Cdc25C protein levels in AS PCa cells, which is in part by decreasing its degradation. PMID: 23637932 dose-dependent Cdc25c phosphatase acts as an early G2-phase checkpoint, thus indicating mechanistic importance in the low-dose hyper-radiosensitivity and induced radioresistance transition PMID: 22843362 data suggest that the maintenance of CDC25 activity does not fully rely on the thioredoxin reductase system in breast cancer cells, even in the presence of a major oxidative stress PMID: 22360685 cloning and functional analysis of Cdc25C PMID: 22394631 MMEQ induced G2/M arrest through the promotion of cdc25c in TSGH8301 cells. PMID: 22021033 Inhibition of CK2 activity by three different inhibitors led to a down-regulation of the level of cdc25C. PMID: 21750987 Two additional sites other than Ser216 in the widely studied cell division cycle (Cdc) protein 25C, whose function depends on 14-3-3 binding, were identified. PMID: 21189416 The results show for the first time that in human mitosis, distinct phospho-isoforms of cdc25C exist with different localizations and interacting partners. PMID: 20668692 ATM and Chk1/2 mediated phosphorylation of cdc25c plays a major role in cell cycle arrest induced by pectenotoxin2. PMID: 20514472 CDC25C and phospho-CDC25C (Ser216) play a crucial role in the pathogenesis and/or progression of vulvar squamous cell carcinomas. PMID: 20500813 Adventitious arsenate reductase activity of the catalytic domain of the human and Cdc25C phosphatases PMID: 20025242 Analysis of cell cycle profile and cell cycle regulatory proteins indicated that arsenite arrested cell cycle at G(2)/M phase, partially through induction of cell division cycle 25 (Cdc25) isoform C (Cdc25C) degradation via ubiquitin-proteasome pathways PMID: 11842186 results suggest that Plk1 phosphorylates Cdc25C on Ser198 and regulates nuclear translocation of Cdc25C during prophase PMID: 11897663 role of degradation by oxidative stress in induction of cell cycle arrest PMID: 11925443 Human CDC25B and CDC25C differ by their ability to restore a functional checkpoint response after gene replacement in fission yeast PMID: 12099692 Ca2+ promotes erythrocyte band 3 tyrosine phosphorylation via dissociation of phosphotyrosine phosphatase from band 3. PMID: 12175337 phosphorylation by Chk2 PMID: 12386164 CDC25C is phosphorylated on Ser 214 during mitosis which, in turn, prevents phosphorylation of Ser 216. HeLa cells depeleted of endogenous CDC25C, when treated with exogenous CDC25C, had a substantial delay to mitotic entry. PMID: 12766774 cdc25C not only plays a role at the G2/M transition but also in the modulation of DNA replication PMID: 12857880 CDC25C translocation to the cell nucleus upon entry into mitosis is coordinated by Plk3 PMID: 14968113 binding to VPR protein in human cell lines correlates with G2 arrest PMID: 14972559 downregulation of Cdc25C is mediated by p53 via two independent mechanisms, one involving direct binding to the cdc25C promoter PMID: 15574328 Vpr promotes cell cycle arrest at the G(2)/M phase by facilitating association of 14-3-3 and Cdc25C PMID: 15708996 Vitamin C transiently arrests cancer cell cycle progression in S phase and G2/M boundary by modulating the kinetics of activation of CDC25C. PMID: 15887239 Data suggests that CDC25C might play an important role in prostate cancer progression and could be used to monitor and predict the aggressiveness of this disease. PMID: 16000564 Data suggest that Pim-1 activates Cdc25C by a direct phosphorylation and can thereby assume the function of a positive cell cycle regulator at the G2/M transition. PMID: 16356754 Crystallization experiments of PLK1 protein in complex with an unphosphorylated and a phosphorylated target peptide from Cdc25C yield crystals suitable for X-ray diffraction analysis. PMID: 16582488 These results demonstrate that the MAPK ERK signaling pathway contributes to the p53-independent antiproliferative functions of p14ARF. Furthermore, they identify a new mechanism by which phosphorylation at serine 216 participates to Cdc25C inactivation. PMID: 16582626 Phosphorylation of cdc25c can be used to test whether a pharmacologic inhibitor of Plk1 would exert the same cellular effects as interference with Plk1 on an mRNA level. PMID: 16648550 Chk1-mediated phosphorylation of Cdc25C plays a major role in response to LOR-mediated G(2)/M arrest. Although the Chk1-mediated cell growth arrest in a tumor cell line. PMID: 16649252

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.