Recombinant Human M-Phase Inducer Phosphatase 3 (CDC25C) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-03641P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human M-Phase Inducer Phosphatase 3 (CDC25C) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-03641P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human M-Phase Inducer Phosphatase 3 (CDC25C) Protein (His) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P30307 |
| Target Symbol | CDC25C |
| Synonyms | CDC 25; Cdc 25C; CDC25; CDC25C; Cell division cycle 25 homolog C; Cell division cycle 25C; Cell division cycle 25C protein; Dual specificity phosphatase Cdc25C; M phase inducer phosphatase 3; M-phase inducer phosphatase 3; Mitosis inducer CDC25; MPIP3; MPIP3_HUMAN; Phosphotyrosine phosphatase; PPP1R60; protein phosphatase 1, regulatory subunit 60 |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-6His |
| Target Protein Sequence | MSTELFSSTREEGSSGSGPSFRSNQRKMLNLLLERDTSFTVCPDVPRTPVGKFLGDSANLSILSGGTPKRCLDLSNLSSGEITATQLTTSADLDETGHLDSSGLQEVHLAGMNHDQHLMKCSPAQLLCSTPNGLDRGHRKRDAMCSSSANKENDNGNLVDSEMKYLGSPITTVPKLDKNPNLGEDQAEEISDELMEFSLKDQEAKVSRSGLYRSPSMPENLNRPRLKQVEKFKDNTIPDKVKKKYFSGQGKLRKGLCLKKTVSLCDITITQMLEEDSNQGHLIGDFSKVCALPTVSGKHQDLKYVNPETVAALLSGKFQGLIEKFYVIDCRYPYEYLGGHIQGALNLYSQEELFNFFLKKPIVPLDTQKRIIIVFHCEFSSERGPRMCRCLREEDRSLNQYPALYYPELYILKGGYRDFFPEYMELCEPQSYCPMHHQDHKTELLRCRSQSKVQEGERQLREQIALLVKDMSP |
| Expression Range | 1-473aa |
| Protein Length | Full Length |
| Mol. Weight | 57.4kDa |
| Research Area | Cell Biology |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Functions as a dosage-dependent inducer in mitotic control. Tyrosine protein phosphatase required for progression of the cell cycle. When phosphorylated, highly effective in activating G2 cells into prophase. Directly dephosphorylates CDK1 and activates its kinase activity. |
| Subcellular Location | Nucleus. |
| Protein Families | MPI phosphatase family |
| Database References | HGNC: 1727 OMIM: 157680 KEGG: hsa:995 STRING: 9606.ENSP00000321656 UniGene: PMID: 30097580 |
