Recombinant Human Lysophospholipase 1/LPL-I Protein
Beta LifeScience
SKU/CAT #: BLA-5513P
Recombinant Human Lysophospholipase 1/LPL-I Protein
Beta LifeScience
SKU/CAT #: BLA-5513P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Host Species | Human |
| Accession | O75608 |
| Synonym | Acyl protein thioesterase 1 Acyl-protein thioesterase 1 APT 1 APT-1 APT1 hAPT1 LPL-I LPL1 LYPA1_HUMAN LYPLA 1 LYPLA1 Lysophospholipase 1 Lysophospholipase I Lysophospholipid specific lysophospholipase LYSOPLA LysoPLA I |
| Description | Recombinant Human Lysophospholipase 1/LPL-I Protein was expressed in E.coli. It is a Full length protein |
| Source | E.coli |
| AA Sequence | MCGNNMSTPLPAIVPAARKATAAVIFLHGLGDTGHGWAEAFAGIRSSHIK YICPHAPVRPVTLNMNVAMPSWFDIIGLSPDSQEDESGIKQAAENIKALI DQEVKNGIPSNRIILGGFSQGGALSLYTALTTQQKLAGVTALSCWLPLRA SFPQGPIGGANRDISILQCHGDCDPLVPLMFGSLTVEKLKTLVNPANVTF KTYEGMMHSSCQQEMMDVKQFIDKLLPPID |
| Molecular Weight | 25 kDa |
| Purity | Greater than 95% SDS-PAGE |
| Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
| Formulation | Liquid Solution |
| Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
| Reconstitution | See related COA |
| Unit Definition | For Research Use Only |
| Storage Buffer | Shipped on Dry Ice. Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle. |
