Recombinant Human Lysophosphatidic Acid Receptor 3 (LPAR3) Protein (His&Myc)

Name: Recombinant Human Lysophosphatidic Acid Receptor 3 (LPAR3) Protein (His&Myc)
Brand: Beta LifeScience
SKU: BLC-07840P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Lysophosphatidic Acid Receptor 3 (LPAR3) Protein (His&Myc) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	Q9UBY5
Target Symbol	LPAR3
Synonyms	Lysophosphatidic acid receptor Edg-7
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-10His&C-Myc
Target Protein Sequence	EDMYGTMKKMICCFSQENPERRPSRIPSTVLSRSDTGSQYIEDSISQGAVCNKSTS
Expression Range	298-353aa
Protein Length	Partial
Mol. Weight	11.3 kDa
Research Area	Cardiovascular
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Receptor for lysophosphatidic acid (LPA), a mediator of diverse cellular activities. May play a role in the development of ovarian cancer. Seems to be coupled to the G(i)/G(o) and G(q) families of heteromeric G proteins.
Subcellular Location	Cell membrane; Multi-pass membrane protein.
Protein Families	G-protein coupled receptor 1 family
Database References	HGNC: 14298 OMIM: 605106 KEGG: hsa:23566 STRING: 9606.ENSP00000359643 UniGene: PMID: 29239275 The results indicate that LPA2 and LPA3 receptors play opposing roles during red blood cells differentiation. PMID: 27244685 myeloma cells stimulate mesenchymal stem cells (MSCs to produce autotaxin, an indispensable enzyme for the biosynthesis of lysophosphatidic acid, and LPA receptor 1 (LPA1) and 3 (LPA3) transduce opposite signals to MSCs to determine the fate of MSCs. PMID: 27641212 Expression profiles reveal LPAR3 (lysophosphatidic acid receptor 3) as a mediator for mitotic phosphorylation-driven pancreatic cell motility and invasion. Together, this work identifies YAP as a novel regulator of pancreatic cancer cell motility, invasion and metastasis. PMID: 26440309 These data indicated that the expression of LPA receptor 3 was increased in human triple-negative breast cancers and is associated with tumor metastatic ability. PMID: 25209561 Suggest that LPA2 and LPA3 may function as a molecular switch and play opposing roles during megakaryopoiesis of K562 cells. PMID: 25463482 The results demonstrate LPA-stimulated migration in oral carcinoma cells through LPAR3, mediated further by PKC, which acts either in concert with or independently of EGFR transactivation PMID: 24928086 LPA3 mRNA is clearly expressed in human PANC-1 tumor cells. PMID: 24061591 Lysophosphatidic acid (LPA) increased hepatocellular carcinoma cells cell invasion, which was LPA-receptor dependent. PMID: 23569130 in the normal human menstrual cycle, lysophosphatidic acid receptor 3 messenger RNA and protein expression change, indicating that this gene may be related to the function of the endometrium. PMID: 22872026 The results indicated that LPA(3) acts as a positive regulator of cell motility and invasion in sarcoma cells, suggesting that LPA signaling pathway via LPA(3) may be involved in the progression of sarcoma cells. PMID: 23167620 High LPAR3 expression is associated with aggressiveness of breast carcinoma. PMID: 22922883 LPA3 Receptor act as a negative regulator on cell motile and invasive abilities of colon cancer. PMID: 22763559 found that LPA receptor 2/3-mediated IL-8 expression occurs through Gi/PI3K/AKT, Gi/PKC and IkappaB/NF-kappaB signaling PMID: 21964883 study found that LPS induces both ATX and LPA3 expression in THP-1 cells; the PKR and SPK1-mediated pathways are involved in both ATX and LPA3 induction, resulting in the coordinate up-regulation of these two genes PMID: 22314276 Mutation in LPA3 gene indicate that the alterations in LPA receptor gene may play some role in pathogenesis in human osteosarcoma cells. PMID: 21116120 Data show that CLL cells express LPA receptors LPA(1-5) and VEGF receptors, and the plasma levels of VEGF are elevated in CLL patients. PMID: 19860625 show that human microglia express LPA receptor subtypes LPA(1), LPA(2), and LPA(3) on mRNA and protein level. LPA activation of C13NJ cells induced Rho and extracellular signal-regulated kinase activation and enhanced cellular ATP production. PMID: 19899077 demonstrate that two biological fluids, blood plasma and seminal plasma, differentially activate LPA receptors PMID: 12123830 results suggested that lysophosphatidic acid (LPA) receptors LPA(2) and LPA(3) may be involved in VEGF expression mediated by LPA signals in human ovarian oncogenesis PMID: 12668280 data suggest that endothelial differentiation gene EDG-7 regulates Lysophosphatidic acid(LPA)-mediated mesangial cell proliferation and suggest that EDG-7 and EDG-2 LPA receptors play a diverse role in mesangial cell proliferation PMID: 15292052 expression of LPA-induced inflammatory response genes is mediated by LPA1 and LPA3 PMID: 17923111 Lysophosphatidic acid receptor 3 may contribute to the pathogenesis of rheumatoid arthritis through the modulation of fibroblast-like synoviocyte migration and cytokine production. PMID: 18006645 Lysophosphatidic acid might regulate VEGF-C and lymphatic marker expression in endothelial cells, which contributes to endothelial cell tube formation in vitro and in vivo, thus facilitating endothelial cell participation lymphangiogenesis. PMID: 18627789 Expression of LPA3 during ovarian carcinogenesis contributes to ovarian cancer aggressiveness, suggesting that the targeting of LPA production and action may have potential for the treatment of ovarian cancer. PMID: 19001604 Switching of LPA receptor expression from LPA3 to LPA1, may be involved in prostate cancer progression and/or androgen independence PMID: 19025891 LPA(1) receptor, LPA(2) and LPA(3) receptors-induced VASP phosphorylation is a critical mediator of tumor cell migration initiation PMID: 19081821 LPA-stimulated cell growth is mediated by distinct but overlapping receptors and signaling pathways in these two model ovarian cancer cell lines. PMID: 19420982

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.