Recombinant Human Lysine-Specific Demethylase 5A (KDM5A) Protein (His-SUMO)

Name: Recombinant Human Lysine-Specific Demethylase 5A (KDM5A) Protein (His-SUMO)
Brand: Beta LifeScience
SKU: BLC-10854P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Product Overview

Description	Recombinant Human Lysine-Specific Demethylase 5A (KDM5A) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P29375
Target Symbol	KDM5A
Synonyms	Histone demethylase JARID1A; JARID1A; Jumonji/ARID domain containing protein 1A; Jumonji/ARID domain-containing protein 1A; Kdm5a; KDM5A_HUMAN; Lysine-specific demethylase 5A; RBBP-2; RBBP2; RBP2; Retinoblastoma binding protein 2; Retinoblastoma-binding protein 2
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His-SUMO
Target Protein Sequence	EYALSGWNLNNMPVLEQSVLAHINVDISGMKVPWLYVGMCFSSFCWHIEDHWSYSINYLHWGEPKTWYGVPSHAAEQLEEVMRELAPELFESQPDLLHQLVTIMNPNVLMEHGVPVYRTNQCAGEFVVTFPRAYHSGFNQGYNFAEAVNFCTADWLPIGRQCVNHYR
Expression Range	437-603aa
Protein Length	Full Length of Mature Protein
Mol. Weight	35.3kDa
Research Area	Transcription
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Histone demethylase that specifically demethylates 'Lys-4' of histone H3, thereby playing a central role in histone code. Does not demethylate histone H3 'Lys-9', H3 'Lys-27', H3 'Lys-36', H3 'Lys-79' or H4 'Lys-20'. Demethylates trimethylated and dimethylated but not monomethylated H3 'Lys-4'. Regulates specific gene transcription through DNA-binding on 5'-CCGCCC-3' motif. May stimulate transcription mediated by nuclear receptors. Involved in transcriptional regulation of Hox proteins during cell differentiation. May participate in transcriptional repression of cytokines such as CXCL12. Plays a role in the regulation of the circadian rhythm and in maintaining the normal periodicity of the circadian clock. In a histone demethylase-independent manner, acts as a coactivator of the CLOCK-ARNTL/BMAL1-mediated transcriptional activation of PER1/2 and other clock-controlled genes and increases histone acetylation at PER1/2 promoters by inhibiting the activity of HDAC1. Seems to act as a transcriptional corepressor for some genes such as MT1F and to favor the proliferation of cancer cells.
Subcellular Location	Nucleus, nucleolus. Nucleus.
Protein Families	JARID1 histone demethylase family
Database References	HGNC: 9886 OMIM: 180202 KEGG: hsa:5927 STRING: 9606.ENSP00000382688 UniGene: Hs.76272

Gene Functions References

ZEB1 play a crucial role in KDM5A induced function. PMID: 29324315
both KDM5A and KDM5B are involved in the lengthening of DICER1 PMID: 28138513
RBP2 promotes HIF-1alpha-VEGF-induced angiogenesis of non-small cell lung cancer via the Akt pathway. PMID: 25162518
promotes overexpression and activation of BCL2 in acute lymphoblastic leukemia development and progression PMID: 27008505
Ectopic overexpression of RBP2 can induce cancer stem cell-like (CSC) phenotypes through epithelial to mesenchymal transition in renal cell carcinoma cells by converting them to a more mesenchymal phenotype. PMID: 27282106
miR-34a promotes the osteogenic differentiation of human adipose-derived stem cells via the RBP2/NOTCH1/CYCLIN D1 coregulatory network. PMID: 27453008
This study aimed to explore the expression level of RBP2 in hepatocellular carcinoma (HCC) and its prognostic significance. PMID: 28582381
KDM5A suppresses ovarian cancer cell apoptosis under paclitaxel treatment. PMID: 28714030
KDM5A 5A inhibitor blocks cancer cell growth and drug resistance PMID: 27224921
KDM5A-mediated H3K4me3 modification participated in the etiology of osteoporosis and may provide new strategies to improve the clinical efficacy of BMP2 in osteoporotic conditions. PMID: 27512956
KDM5A demethylates H3K4 to allow ZMYND8-NuRD to operate within damaged chromatin to repair DNA double strand breaks. PMID: 28572115
the radiation sensitivity observed following depletion of Jarid1A is not caused by a deficiency in repair of DNA double-strand breaks. PMID: 27253695
Treatment-induced temozolimide resistance in glioblastoma cells involves KDM5A mediated epigenetic mechanisms. PMID: 26566863
Characterization of a Linked Jumonji Domain of the KDM5/JARID1 Family of Histone H3 Lysine 4 Demethylases. PMID: 26645689
KDM5A is regulated by its reader domain through a positive-feedback mechanism PMID: 25686748
Data indicate that lysine (K)-specific demethylase 5A RBP2 (JARID1A; KDM5A) epigenetically downregulated micrRNA-21 (miR-21) in blast transformation of chronic myeloid leukemia (CML). PMID: 25575817
LSD1 is a more sensitive molecular marker than RBP2 on thyroid cancer diagnosis. PMID: 24068396
MiR-212 directly regulates the expression of RBP2 and inhibits cell growth in gastric cancer, which may provide new clues to treatment. PMID: 23794145
RBP2 is critical for breast cancer metastasis to the lung in multiple in vivo models. Mechanistically, RBP2 promotes metastasis as a pleiotropic positive regulator of many metastasis genes, including TNC. PMID: 24582965
RBP2 is overexpressed in HCC and negatively regulated by hsa-miR-212. The hsa-miR-212-RBP2-CDKI pathway may be important in the pathogenesis of HCC. PMID: 23922798
Overexpression of RBP2 and activation of VEGF might play important roles in human gastric cancer development and progression. PMID: 24716659
RBP2 is overexpressed in gastric cancer, and its inhibition triggers senescence of malignant cells at least partially by derepressing its target genes cyclin-dependent kinase inhibitors. PMID: 19850045
our results establish an oncogenic role for RBP2 in lung tumorigenesis and progression and uncover novel RBP2 targets mediating this role. PMID: 23722541
RBP2 down-regulated the expression of E-cadherin, up-regulated the expression of N-cadherin and snail, and induced epithelial-mesenchymal transition in non-small cell lung cancer cells. PMID: 24376841
RBP2 may link chronic inflammation to tumor development. PMID: 25015565
Epigenetic changes mediated by JARID1A, SMYD3 and DNA methylation may be responsible, at least in part, for the functional progesterone withdrawal that precipitates human labour. PMID: 24442343
KDM5A and the NuRD complex cooperatively function to control developmentally regulated genes PMID: 25190814
ARID is required for RBP2 demethylase activity in cells and that DNA recognition is essential to regulate transcription PMID: 18270511
High expression of KDM3B and KDM5A is associated with a better prognosis (no recurrence after mastectomy p=0.005 and response to docetaxel p=0.005)in breast cancer patients. PMID: 23266085
In terminally differentiated cells, common KDM5A and E2F4 gene targets were bound by the pRB-related protein p130, a DREAM complex component. PMID: 23093672
Jarid1a/b-mediated H3K4 demethylation contributes to silencing of retinoblastoma target genes in senescent cells, suggesting a mechanism by which retinoblastoma triggers gene silencing. PMID: 22615382
Evidence was provided that chronic drug exposure generated drug-tolerant cells via epigenetic mechanisms involving molecules such as CD44 and KDM5A. PMID: 21935404
JARID1A or a locus in strong linkage disequilibrium with it is a positional candidate for susceptibility to AS. PMID: 21562575
that H3K4 tri- and dimethylation play an important role and JARID1A is the histone-demethylating enzyme responsible for removal of this mark PMID: 21348942
Mad1 recruits RBP2 to the hTERT promoter that, in turn, demethylates H3-K4, thereby contributing to a stable repression of the hTERT gene in normal or differentiated malignant cells. PMID: 19762557
that RBP2-H1 exerts a broad tumor-suppressive function partially mediated by pRb modulation PMID: 16645588
Study shows that RBP2 is displaced from Hox genes during embryonic stem cell differentiation correlating with an increase of their di- and trimethylated histone 3 lysine 4 levels and expression. PMID: 17320161
RBP2 associates with MRG15 complex to maintain reduced H3K4 methylation at transcribed regions, which may ensure the transcriptional elongation state PMID: 17573780
During differentiation, RBP2 exerts inhibitory effects on multiple genes through direct interaction with their promoters. PMID: 18722178
fusing an H3K4-trimethylation-binding PHD finger, such as the carboxy-terminal PHD finger of JARID1A, to a common fusion partner NUP98, generated potent oncoproteins that arrested haematopoietic differentiation and induced acute myeloid leukaemia PMID: 19430464

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.