Recombinant Human Lysine-Specific Demethylase 3B (KDM3B) Protein (His-SUMO&Myc)
Beta LifeScience
SKU/CAT #: BLC-02492P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Lysine-Specific Demethylase 3B (KDM3B) Protein (His-SUMO&Myc)
Beta LifeScience
SKU/CAT #: BLC-02492P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Lysine-Specific Demethylase 3B (KDM3B) Protein (His-SUMO&Myc) is produced by our E.coli expression system. This is a protein fragment. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | Q7LBC6 |
| Target Symbol | KDM3B |
| Synonyms | 5qNCA; C5orf7; JHDM2B; JmjC domain containing histone demethylation protein 2B; JmjC domain-containing histone demethylation protein 2B; jmjd1b; Jumonji domain containing 1B; Jumonji domain containing protein 1B; Jumonji domain-containing protein 1B; KDM3B; KDM3B_HUMAN; KIAA1082; Lysine (K) specific demethylase 3B ; Lysine-specific demethylase 3B; NET22; Nuclear protein 5qNCA |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-10His-SUMO&C-Myc |
| Target Protein Sequence | MPTRFEDLMENLPLPEYTKRDGRLNLASRLPSYFVRPDLGPKMYNAYGLITAEDRRVGTTNLHLDVSDAVNVMVYVGIPIGEGAHDEEVLKTIDEGDADEVTKQRIHDGKEKPGALWHIYAAKDAEKIRELLRKVGEEQGQENPPDHDPIHDQSWYLDQTLRKRLYEEYGVQGWAIVQFLGDAVFIPAGAPHQVHNLYSCIKVAEDFVSPEHVKHCFRLTQEFR |
| Expression Range | 1498-1721aa |
| Protein Length | Partial |
| Mol. Weight | 45.6kDa |
| Research Area | Epigenetics And Nuclear Signaling |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Histone demethylase that specifically demethylates 'Lys-9' of histone H3, thereby playing a central role in histone code. Demethylation of Lys residue generates formaldehyde and succinate. May have tumor suppressor activity. |
| Subcellular Location | Nucleus. |
| Protein Families | JHDM2 histone demethylase family |
| Database References | HGNC: 1337 OMIM: 609373 KEGG: hsa:51780 STRING: 9606.ENSP00000326563 UniGene: PMID: 28540746 |
