Recombinant Human Lymphotoxin-Alpha (LTA) Protein (His), Active
Beta LifeScience
SKU/CAT #: BLC-05838P
Greater than 95% as determined by SDS-PAGE.
Activity Measured by its binding ability in a functional ELISA. Immobilized LTA at 5 μg/ml can bind human TNFRSF1B , the EC 50 is 1.632-2.699 ng/ml. Biological Activity Assay
Activity Measured by its binding ability in a functional ELISA. Immobilized LTA at 5 μg/ml can bind human TNFR1, the EC 50 of human LTA protein is 4.409-6.797 ng/ml. Biological Activity Assay
Recombinant Human Lymphotoxin-Alpha (LTA) Protein (His), Active
Beta LifeScience
SKU/CAT #: BLC-05838P
Collections: All products, Antibody / cell therapy targets, Antibody therapeutic / adc target proteins, Buy cytokines, chemokines, and growth factors for research online, Growth factors and receptors for advanced research, High-quality cytokines for advanced research, High-quality recombinant proteins, Tumor necrosis factors and receptors (tnfs)
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Lymphotoxin-Alpha (LTA) Protein (His), Active is produced by our Mammalian cell expression system. This is a full length protein. |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxin | Less than 1.0 EU/ug as determined by LAL method. |
| Activity | 1. Measured by its binding ability in a functional ELISA. Immobilized LTA at 5 μg/ml can bind human TNFRSF1B , the EC 50 is 1.632-2.699 ng/ml. 2. Measured by its binding ability in a functional ELISA. Immobilized LTA at 5 μg/ml can bind human TNFR1, the EC 50 of human LTA protein is 4.409-6.797 ng/ml. |
| Uniprotkb | P01374 |
| Target Symbol | LTA |
| Synonyms | (LT-alpha)(TNF-beta)(TNFB)(TNFSF1) |
| Species | Homo sapiens (Human) |
| Expression System | Mammalian cell |
| Tag | N-6His |
| Target Protein Sequence | LPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL |
| Expression Range | 35-205aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 20.8 kDa |
| Form | Lyophilized powder |
| Buffer | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Cytokine that in its homotrimeric form binds to TNFRSF1A/TNFR1, TNFRSF1B/TNFBR and TNFRSF14/HVEM. In its heterotrimeric form with LTB binds to TNFRSF3/LTBR. Lymphotoxin is produced by lymphocytes and is cytotoxic for a wide range of tumor cells in vitro and in vivo. |
| Subcellular Location | Secreted. Membrane. Note=The homotrimer is secreted. The heterotrimer is membrane-associated. |
| Protein Families | Tumor necrosis factor family |
| Database References | HGNC: 6709 OMIM: 153440 KEGG: hsa:4049 STRING: 9606.ENSP00000403495 UniGene: PMID: 28476335 |
