Recombinant Human Lymphotoxin-Alpha (LTA), Active

Beta LifeScience SKU/CAT #: BLC-06025P
Greater than 95% as determined by SDS-PAGE.
Greater than 95% as determined by SDS-PAGE.

Recombinant Human Lymphotoxin-Alpha (LTA), Active

Beta LifeScience SKU/CAT #: BLC-06025P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human Lymphotoxin-Alpha (LTA), Active is produced by our E.coli expression system. This is a full length protein.
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Activity The ED50 as determined in a cytotoxicity assay using L-929 mouse fibroblast cells in the presence of the metabolic inhibitor actinomycin D is less than 100 pg/ml.
Uniprotkb P01374
Target Symbol LTA
Synonyms LTalpha; DAMA-25N12.13-004; DIF; LT alpha; LT; LT-alpha; Lta; Lymphotoxin alpha (TNF superfamily, member 1); Lymphotoxin alpha; Lymphotoxin-alpha; MGC117668; OTTHUMP00000037612; OTTHUMP00000037613; TNF B; TNF superfamily member 1; TNF, lymphocyte-derived; TNF-beta; TNFB; TNFB_HUMAN; TNFbeta; TNFSF 1; TNFSF1; TNLG1E; Tumor necrosis factor beta; tumor necrosis factor ligand 1E; Tumor necrosis factor ligand superfamily member 1; tumor necrosis factor superfamily member 1
Species Homo sapiens (Human)
Expression System E.coli
Tag Tag-Free
Complete Sequence LPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL
Expression Range 35-205aa
Protein Length Full Length of Mature Protein
Mol. Weight 18.8 kDa
Research Area Cancer
Form Lyophilized powder
Buffer Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Cytokine that in its homotrimeric form binds to TNFRSF1A/TNFR1, TNFRSF1B/TNFBR and TNFRSF14/HVEM. In its heterotrimeric form with LTB binds to TNFRSF3/LTBR. Lymphotoxin is produced by lymphocytes and is cytotoxic for a wide range of tumor cells in vitro and in vivo.
Subcellular Location Secreted. Membrane. Note=The homotrimer is secreted. The heterotrimer is membrane-associated.
Protein Families Tumor necrosis factor family
Database References
Associated Diseases Psoriatic arthritis (PSORAS)

Gene Functions References

  1. The LTA were significantly increased in SZ patients, but no significant difference in the mRNA levels of LTA was observed between SZ patients and NC subjects. PMID: 28476335
  2. There are independent and additive interactions between LTalpha +252 G/G genotype, chronic viral hepatitis, and habits of substance use on risk of hepatocellular carcinoma. PMID: 28738973
  3. Independent and additive interaction between polymorphisms of TNFalpha -308 and lymphotoxin alpha +252 on risk of hepatocellular carcinoma related to hepatitis B has been reported. PMID: 28865603
  4. The C allele for rs1042522 in p53 was genetically associated with a higher risk for RD but not for PVR in this cohort. This is the first association study attempting replication of PVR-associated risk alleles in a nonwhite population. PMID: 28106707
  5. The results of this study showed that neither -252 G/A nor -804 C/A polymorphism of the LTA gene was found to be associated with overall stroke as well as any subtype of IS excluding SVD in North Indian population. PMID: 26707826
  6. this study found an association between the single nucleotide polymorphism LTA +252 with the development of sepsis in Colombian patients PMID: 27592234
  7. Fequencies of polymorphic allele and genotypes for the lymphotoxin-alpha gene, position +252 (rs909253), in Brazilian women with preeclampsia PMID: 26561241
  8. The allelic frequencies of LTA SNPs were found to be significantly associated with the risk of oral cancer and precancerous lesions PMID: 27312561
  9. rs909253 in LTA was identified to be significantly associated with ankylosing spondylitis susceptibility in this study population, but no significant association was found between ankylosing spondylitis risk and LTA rs2239704 or rs2229094 PMID: 28489756
  10. study showed that heterozygous variant (AG) genotype of TNF-beta was associated with persistent primary immune thrombocytopenia, when compared with controls PMID: 26761582
  11. a positive correlation of HLA-DRB1*12 and a negative correlation of HLA-DRB1*13 with younger patientsTNFb4 allele's negative association with older patients displaying higher PSA levels, higher GS and positive surrounding tissue involvement; positive association of TNFb5 allele for both older and younger patients PMID: 27102235
  12. the present study suggests LTa +252G as a risk alleles for disease susceptibility associated with higher serum levels of LTa and concomitant discrete clinical features among Indian systemic lupus erythematosus patients in India PMID: 27838362
  13. this study shows that TNF-b is elevated in wound exudates of patients with hidradenitis suppurativa PMID: 27819528
  14. LTA -804C/A gene polymorphism is not found to be associated with the susceptibility of ischemic stroke in both Asian as well as in Caucasian population. PMID: 27411794
  15. After multivariable analysis TNF-alpha polymorphism showed no consistent association with leukemia. CONCLUSIONS: This meta-analysis suggests that the LT-alpha +252 AA polymorphism is associated with the risk of leukemia PMID: 27647233
  16. Tumor Necrosis Factor and Lymphotoxin in Regulation of Intestinal Inflammation. PMID: 27914457
  17. joint effects of these CRP, TNF-alpha, and LTA risk alleles with physical inactivity in elders were observed, suggesting that physical activity may modulate effects of genotypes on handgrip strength. PMID: 27056089
  18. No association was found between two promoter variants of TNF and LTA, and diabetic retinopathy in a large cohort of Caucasian patients with type 1 diabetes and type 2 diabetes PMID: 26821796
  19. Polymorphism +252 LT gene did not show any significant association with COPD. PMID: 26932696
  20. TNFB+252G/A was associated with presence of immune thrombocytopenia. PMID: 26076780
  21. LTalpha plays a role in malignant angiogenesis and disease progression in Cutaneous T cell lymphoma and may serve as a therapeutic target in this disease. PMID: 25915535
  22. LTA polymorphism is associated with genetic susceptibility of systemic lupus in Asians, but not in rheumatoid arthritis. PMID: 25931031
  23. Studied the association between immuno-modulatory gene polymorphisms (including LTA) and risk for nasal NK/T-cell lymphoma in a Chinese population. Found The LTA +252 GA + AA genotypes were associated with increased risk for NK/T-cell lymphoma. PMID: 26108796
  24. TNF-beta NcoI polymorphism, by itself, was not associated with increased stroke susceptibility. But the homozygous genotype for the allele TNFB2 was associated with higher expression of classical inflammatory and metabolic markers of stroke. PMID: 25063351
  25. These results support an association between ANKK1 and LTA genetic markers and vulnerability to schizophrenia and show the potential influence of just one copy of the mutant C or G allele in the Egyptian population. PMID: 26114114
  26. Studied six SNP loci: (rs2279115 of BCL2 gene, rs804270 of NEIL2 gene, rs909253 of LTA gene, rs2294008 of PSCA gene, rs3765524 and rs10509670 of PLCE1 gene) to evaluate gastric cancer risk using magnetic nanoparticles and universal tagged arrays. PMID: 26554163
  27. TNF-alpha (-308G/A), TNF-beta (+252A/G) and IL-10 (-1082G/A, -819C/T and -592C/A) polymorphisms are associated with the susceptibility of oral lichen planus. PMID: 26221924
  28. Elite controllers of HIV infection present marginal zone-like B-cell populations which IL-10 and LT-alpha expression profiles may favour homeostasis of immune responses and lymphoid microenvironments. PMID: 25003989
  29. Biotin-pulldown assay showed that HuR specifically interacts with the 3'-untranslated region (3'-UTR) of the LTalpha mRNA PMID: 25980610
  30. The AA genotype of LT-alpha + 252 was significantly associated with shortened overall or leukemia-free survival in patients with myelodysplastic syndrome with excess blasts. PMID: 23931336
  31. MTHFR, TGFbeta1, and TNFB polymorphisms are not significantly associated with the risk of osteoporosis in rheumatoid arthritis. PMID: 25981594
  32. statistical evidence for the interactions between 1) TNF/LTA SNP rs2229094 and depression symptoms for average pain intensity and duration and 2) IL1B two SNP diplotype and kinesiophobia for average shoulder pain intensity PMID: 24598699
  33. The TNFB2/B2 genotype of TNF-beta NcoI polymorphism was associated with increased inflammatory and metabolic markers and this association was different according to sex of MS patients. PMID: 25173940
  34. Review/Meta-analysis: Suggest lymphotoxin-alpha +252A/G gene polymorphism is a risk factor for NHL in North Americans, and this polymorphism may contribute to diffuse large B cell lymphoma susceptibility. PMID: 24610621
  35. Combinations of cytokine gene network polymorphic markers as potential predictors of myocardial infarction PMID: 25735143
  36. The findings appear to support the hypothesis that genetic variability of 252A>G polymorphism in TNF-beta region may modulate risk of migraine in the population of Asian ancestry. PMID: 24959879
  37. Studies indicate that tumor necrosis factors TNF-alpha/TNF-beta and their receptor TNFR1 and TNFR2 play a regulatory role of different immune cells. PMID: 24896334
  38. This indicates an association between polymorphism of the TNF-beta gene and post-operative sepsis, suggesting the TNFB2/B2 genotype as a high-risk factor for the development of sepsis after elective surgery. PMID: 24796628
  39. IL-6-174 SNP is rare or not seen in the Han population in Guangzhou, so SNP at this locus cannot be selected for disease association analysis. PMID: 25140780
  40. Our findings suggest that Hodgkin and Reed Sternberg cell-derived LTalpha is an important mediator that contributes to T cell recruitment into lesional lymph nodes in Hodgkin lymphoma. PMID: 25139349
  41. TNFB2 allele was associated with the presence of multiple sclerosis independently of HLA-DRB1 in white patients and the TNFB2/B2 genotype was associated with increased TNF-alpha levels in white and brown patients. PMID: 24696164
  42. TNFB +252A/G and exon 3 C/A polymorphisms are associated with vitiligo susceptibility PMID: 24312346
  43. A significant association was detected between LT-alpha +249A/G and increased risk of diabetes, in particular for young-onset patients PMID: 24233435
  44. TNF and LTA genetic polymorphisms contribute to SLE susceptibility in the Egyptian population and are associated with disease characteristics. PMID: 24420856
  45. Polymorphisms of the LTA gene can probably be used with other genetic markers together to identify individuals at high susceptibility to myocardial infarction. PMID: 24642747
  46. These results suggest for the first time that TNF-beta is involved in microenvironment inflammation in chondrocytes during rheumatoid arthritis PMID: 24283517
  47. our meta-analyses suggested that the LTA rs1041981, rs2239704 and rs2229094 polymorphisms contributed to the increased risk of cancers. PMID: 24349304
  48. This study provides evidence for rs1799724 at the LTA/TNFalpha locus as a susceptibility factor for idiopathic achalasia. PMID: 24259423
  49. TNF-alpha -308 A/G and LT-alpha +252 A/G polymorphisms are associated with susceptibility to sarcoidosis in an European population.[META-ANALYSIS] PMID: 24197700
  50. The TNF-beta gene A252G polymorphism might be a potential risk factor for the development of sarcoidosis. (Meta-analysis) PMID: 24244632

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

Recently viewed