Recombinant Human Lymphotoxin-Alpha (LTA), Active
Beta LifeScience
SKU/CAT #: BLC-06025P
Greater than 95% as determined by SDS-PAGE.
Recombinant Human Lymphotoxin-Alpha (LTA), Active
Beta LifeScience
SKU/CAT #: BLC-06025P
Collections: All products, Antibody / cell therapy targets, Antibody therapeutic / adc target proteins, Buy cytokines, chemokines, and growth factors for research online, Growth factors and receptors for advanced research, High-quality cytokines for advanced research, High-quality recombinant proteins, Tumor necrosis factors and receptors (tnfs)
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Lymphotoxin-Alpha (LTA), Active is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxin | Less than 1.0 EU/μg as determined by LAL method. |
| Activity | The ED50 as determined in a cytotoxicity assay using L-929 mouse fibroblast cells in the presence of the metabolic inhibitor actinomycin D is less than 100 pg/ml. |
| Uniprotkb | P01374 |
| Target Symbol | LTA |
| Synonyms | LTalpha; DAMA-25N12.13-004; DIF; LT alpha; LT; LT-alpha; Lta; Lymphotoxin alpha (TNF superfamily, member 1); Lymphotoxin alpha; Lymphotoxin-alpha; MGC117668; OTTHUMP00000037612; OTTHUMP00000037613; TNF B; TNF superfamily member 1; TNF, lymphocyte-derived; TNF-beta; TNFB; TNFB_HUMAN; TNFbeta; TNFSF 1; TNFSF1; TNLG1E; Tumor necrosis factor beta; tumor necrosis factor ligand 1E; Tumor necrosis factor ligand superfamily member 1; tumor necrosis factor superfamily member 1 |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | Tag-Free |
| Complete Sequence | LPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL |
| Expression Range | 35-205aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 18.8 kDa |
| Research Area | Cancer |
| Form | Lyophilized powder |
| Buffer | Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4 |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Cytokine that in its homotrimeric form binds to TNFRSF1A/TNFR1, TNFRSF1B/TNFBR and TNFRSF14/HVEM. In its heterotrimeric form with LTB binds to TNFRSF3/LTBR. Lymphotoxin is produced by lymphocytes and is cytotoxic for a wide range of tumor cells in vitro and in vivo. |
| Subcellular Location | Secreted. Membrane. Note=The homotrimer is secreted. The heterotrimer is membrane-associated. |
| Protein Families | Tumor necrosis factor family |
| Database References | HGNC: 6709 OMIM: 153440 KEGG: hsa:4049 STRING: 9606.ENSP00000403495 UniGene: PMID: 28476335 |
