Recombinant Human Lymphotactin Protein (XCL1) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-08337P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Lymphotactin Protein (XCL1) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-08337P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Lymphotactin Protein (XCL1) Protein (His) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P47992 |
| Target Symbol | XCL1 |
| Synonyms | ATAC; C motif chemokine 1; Chemokine (C motif) ligand 1; Chemokine C Motif Ligand 1; Cytokine SCM-1; LPTN; LTN; Lymphotactin; Lymphotaxin; SCM 1 alpha; SCM 1; SCM 1a; SCM-1-alpha; SCM1; SCM1A; SCYC1; Single cysteine motif 1a; Small inducible cytokine C1; Small Inducible Cytokine Subfamily C Member 1; Small inducible cytokine subfamily C, member 1 (lymphotactin); Small-inducible cytokine C1; X-C motif chemokine ligand 1; XC chemokine ligand 1; Xcl1; XCL1_HUMAN |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-6His |
| Target Protein Sequence | VGSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG |
| Expression Range | 22-114aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 14.3kDa |
| Research Area | Immunology |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Chemotactic activity for lymphocytes but not for monocytes or neutrophils. In thymus, mediates medullary accumulation of thymic dendritic cells and contributes to regulatoy T cell development, playing a role in self-tolerance establishment. |
| Subcellular Location | Secreted. |
| Protein Families | Intercrine gamma family |
| Database References | HGNC: 10645 OMIM: 600250 KEGG: hsa:6375 STRING: 9606.ENSP00000356792 UniGene: PMID: 29027574 |
