Recombinant Human Lymphotactin Protein (XCL1) Protein (His)

Beta LifeScience SKU/CAT #: BLC-08337P
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SDS-PAGE.

Recombinant Human Lymphotactin Protein (XCL1) Protein (His)

Beta LifeScience SKU/CAT #: BLC-08337P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human Lymphotactin Protein (XCL1) Protein (His) is produced by our E.coli expression system. This is a full length protein.
Purity Greater than 90% as determined by SDS-PAGE.
Uniprotkb P47992
Target Symbol XCL1
Synonyms ATAC; C motif chemokine 1; Chemokine (C motif) ligand 1; Chemokine C Motif Ligand 1; Cytokine SCM-1; LPTN; LTN; Lymphotactin; Lymphotaxin; SCM 1 alpha; SCM 1; SCM 1a; SCM-1-alpha; SCM1; SCM1A; SCYC1; Single cysteine motif 1a; Small inducible cytokine C1; Small Inducible Cytokine Subfamily C Member 1; Small inducible cytokine subfamily C, member 1 (lymphotactin); Small-inducible cytokine C1; X-C motif chemokine ligand 1; XC chemokine ligand 1; Xcl1; XCL1_HUMAN
Species Homo sapiens (Human)
Expression System E.coli
Tag N-6His
Target Protein Sequence VGSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG
Expression Range 22-114aa
Protein Length Full Length of Mature Protein
Mol. Weight 14.3kDa
Research Area Immunology
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Chemotactic activity for lymphocytes but not for monocytes or neutrophils. In thymus, mediates medullary accumulation of thymic dendritic cells and contributes to regulatoy T cell development, playing a role in self-tolerance establishment.
Subcellular Location Secreted.
Protein Families Intercrine gamma family
Database References

HGNC: 10645

OMIM: 600250

KEGG: hsa:6375

STRING: 9606.ENSP00000356792

UniGene: PMID: 29027574

  • This study defines a Glycosaminoglycan binding surface on XCL1 dimer that includes residues that are important for HIV-1 inhibition. PMID: 26836755
  • Electrostatics and Hydrophobic Effects in the Metamorphic Protein Human Lymphotactin PMID: 26134347
  • XCL1 acts via direct interaction with the external viral envelope glycoprotein, gp120, to block HIV-1 infection PMID: 26085164
  • analysis of XCL1 and XCL2, members of the C-chemokine subfamily, in the immune system PMID: 25497737
  • XCL1 displays antimicrobial activity against E. coli and S. aureus. PMID: 12949249
  • XCL1-mediated inhibition is associated with direct interaction of the chemokine with the HIV-1 envelope. PMID: 24385911
  • In native annulus fibrosus tissue homeostasis and repair, CXCR3 is evident, whereas XCL1 could not be detected. PMID: 21270681
  • The expression patterns of XCR1 and XCL1 were conserved in human and mice blood cells, including certain dendritic cell subsets. PMID: 20541533
  • Data indicated increased expression of XCL1 in CD4+ and CD8+ T cells in Wegener's granulomatosis (WG), and suggest that XCL1 might be a key modulator of T cell recruitment in WG. PMID: 19797511
  • NMR spectra of human lymphotactin (hLtn), obtained under various solution conditions, have revealed that the protein undergoes a major conformational rearrangement dependent on temperature and salt concentration. PMID: 11889129
  • lymphotactin, as well as MCP-1, may contribute to leukocyte infiltration and disease progression in IgA nephropathy. PMID: 12053063
  • Lptn might be a key modulator for T cell trafficking in the pathogenesis of rheumatoid arthritis PMID: 12847680
  • In humans XCL1 expression is mainly a property of CD8+ T cells; the contribution to its synthesis by different T cell receptor alpha beta-expressing T cell subsets, namely CD4+ lymphocytes, is negligible. PMID: 14568926
  • lymphotactin utilizes highly specific glycosaminoglycan-binding sites PMID: 14707146
  • XCL1 activation is positively correlated with HIV-1 Tat expression in human U87.MG astrocytes in vitro. PMID: 14734774
  • description of a lymphotactin-producing monoclonal T-cell lymphoproliferative disorder with extreme lymphocytopenia and progressive leukoencephalopathy [case report] PMID: 16923584
  • The monocyte-derived dendritic cells can express Lptn mRNA in a maturation-dependent manner. PMID: 17077010
  • Elevated serum lymphotactin levels correlate with relatively milder manifestations in diffuse cutaneous systemic sclerosis (dSSc), especially lower severity of lung involvement, suggesting that lymphotactin may play a role in the development of dSSc. PMID: 18322986
  • functional repertoire and regulation of a single naturally occurring amino acid sequence can be expanded by access to a set of highly dissimilar native-state structures PMID: 18364395
  • XCL1 enhances regulatory activities of CD4+ CD25(high) CD127(low/-) T cells in human allergic asthma PMID: 18832695
  • ATAC Is a GCN5/PCAF-containing acetylase complex with a novel NC2-like histone fold module that interacts with the TATA-binding protein PMID: 18838386
  • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    Recently viewed