Recombinant Human Lymphokine-Activated Killer T-Cell-Originated Protein Kinase (PBK) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-03740P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Lymphokine-Activated Killer T-Cell-Originated Protein Kinase (PBK) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-03740P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Lymphokine-Activated Killer T-Cell-Originated Protein Kinase (PBK) Protein (GST) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | Q96KB5 |
| Target Symbol | PBK |
| Synonyms | Cancer/testis antigen 84; CT84; Epididymis luminal protein 164; FLJ14385; HEL164; Lymphokine activated killer T cell originated protein kinase; Lymphokine-activated killer T-cell-originated protein kinase; MAPKK like protein kinase; MAPKK-like protein kinase; Nori 3; Nori-3; Nori3; PBK; PDZ binding kinase; PDZ-binding kinase; Serine/threonine protein kinase; Spermatogenesis related protein kinase; Spermatogenesis-related protein kinase; SPK; T LAK cell originated protein kinase; T-LAK cell-originated protein kinase; TOPK; TOPK_HUMAN |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-GST |
| Target Protein Sequence | MEGISNFKTPSKLSEKKKSVLCSTPTINIPASPFMQKLGFGTGVNVYLMKRSPRGLSHSPWAVKKINPICNDHYRSVYQKRLMDEAKILKSLHHPNIVGYRAFTEANDGSLCLAMEYGGEKSLNDLIEERYKASQDPFPAAIILKVALNMARGLKYLHQEKKLLHGDIKSSNVVIKGDFETIKICDVGVSLPLDENMTVTDPEACYIGTEPWKPKEAVEENGVITDKADIFAFGLTLWEMMTLSIPHINLSNDDDDEDKTFDESDFDDEAYYAALGTRPPINMEELDESYQKVIELFSVCTNEDPKDRPSAAHIVEALETDV |
| Expression Range | 1-322aa |
| Protein Length | Full Length |
| Mol. Weight | 63.1kDa |
| Research Area | Cell Biology |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Phosphorylates MAP kinase p38. Seems to be active only in mitosis. May also play a role in the activation of lymphoid cells. When phosphorylated, forms a complex with TP53, leading to TP53 destabilization and attenuation of G2/M checkpoint during doxorubicin-induced DNA damage. |
| Protein Families | Protein kinase superfamily, STE Ser/Thr protein kinase family, MAP kinase kinase subfamily |
| Database References | HGNC: 18282 OMIM: 611210 KEGG: hsa:55872 STRING: 9606.ENSP00000301905 UniGene: PMID: 29901068 |
