Recombinant Human Lymphocyte Antigen 96 (LY96) Protein (His)

Beta LifeScience SKU/CAT #: BLC-06146P
Greater than 85% as determined by SDS-PAGE.
Greater than 85% as determined by SDS-PAGE.

Recombinant Human Lymphocyte Antigen 96 (LY96) Protein (His)

Beta LifeScience SKU/CAT #: BLC-06146P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human Lymphocyte Antigen 96 (LY96) Protein (His) is produced by our Baculovirus expression system. This is a full length protein.
Purity Greater than 85% as determined by SDS-PAGE.
Uniprotkb Q9Y6Y9
Target Symbol LY96
Synonyms ESOP 1; ESOP-1; ESOP1 ; LY 96; Ly-96; LY96; LY96_HUMAN; Lymphocyte antigen 96; md 2; MD 2 protein; MD2 protein; Myeloid differentiation protein 2 ; Protein MD 2; Protein MD-2; Protein MD2
Species Homo sapiens (Human)
Expression System Baculovirus
Tag N-10His
Target Protein Sequence QKQYWVCNSSDASISYTYCDKMQYPISINVNPCIELKRSKGLLHIFYIPRRDLKQLYFNLYITVNTMNLPKRKEVICRGSDDDYSFCRALKGETVNTTISFSFKGIKFSKGKYKCVVEAISGSPEEMLFCLEFVILHQPNSN
Expression Range 19-160aa
Protein Length Full Length of Mature Protein
Mol. Weight 17.5
Research Area Immunology
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Binds bacterial lipopolysaccharide (LPS). Cooperates with TLR4 in the innate immune response to bacterial lipopolysaccharide (LPS), and with TLR2 in the response to cell wall components from Gram-positive and Gram-negative bacteria. Enhances TLR4-dependent activation of NF-kappa-B. Cells expressing both LY96 and TLR4, but not TLR4 alone, respond to LPS.
Subcellular Location Secreted, extracellular space. Secreted.
Database References

HGNC: 17156

OMIM: 605243

KEGG: hsa:23643

STRING: 9606.ENSP00000284818

UniGene: PMID: 29036538

  • MD-2 siRNA or plasmid further confirmed the efficacy of Iturin A by suppressing MD-2/TLR4 signaling pathway. The in silico docking study showed that the Iturin A interacted well with the MD-2 in MD-2/TLR4 receptor complex. Conclusively, inhibition of MD-2/TLR4 complex with Iturin A offered strategic advancement in cancer therapy. PMID: 28347875
  • data confirm that engineered human cells expressing TLR4, MD2 and CD14 can respond to CMP with NF-kappaB activation and the response can be influenced by variations in CMP-mannosylation PMID: 29281684
  • The observations suggest that MD-2 helps to regulate lipopolysaccharide-induced NLRP3 inflammasome activation and the inflammatory response in NR8383 cells, and likely does so by affecting MyD88/NF-kappaB signaling. PMID: 28654770
  • MD2 plays an important role in induction of allergic sensitization to cat dander and common pollens relevant to human allergic diseases. PMID: 26586036
  • we report that exogenous CnB is taken up by cells in a time- and concentration-dependent manner via clathrin-dependent receptor-mediated internalization. Our findings further confirm that uptake is mediated by the TLR4/MD2 complex together with the co-receptor CD14 PMID: 27090571
  • In this study, a novel naturally occurring spliceosome of human MD2, termed as MD2-T3, has been identified. PMID: 27317890
  • Results show that cigarette smoke may alter innate immune responses reducing the expression of the MD2, a molecule with an important role in TLR4 signaling. PMID: 26068048
  • Predominantly hydrophobic interactions between MD-2 and TLR4 contribute to the stabilization of the TLR4/MD-2/metal ion complex in a conformation that enables activation. PMID: 25803856
  • The intensity of the intra-amniotic inflammatory response to bacteria or perhaps to other TLR4 ligands may be facilitated through synthesis and release of sMD2 by the amniochorion. PMID: 25605324
  • Three genes (LY96, IL8 DPR) were significantly downregulated over time. This finding was confirmed in a validation cohort of stroke patients (n=8). PMID: 25124890
  • The study revealed the impact of specific residues and regions of MD-2 on the binding of lipolysaccharides and TLR4. PMID: 26320630
  • Gene polymorphisms of MD2 and GM2A were associated with the occurrence or severity of neonatal necrotizing enterocolitis. PMID: 25816011
  • In patients undergoing CABG surgery, we found genetic polymorphisms in LY96 associated with decreased risk of postoperative AF. PMID: 26385043
  • Aminoarabinose residues in lipid A contribute to Burkholderia lipid A binding to the TLR4.Myeloid Differentiation Factor 2 complex. PMID: 26160169
  • TLR4 along with its accessory protein MD-2 builds a heterodimeric complex that specifically recognizes lipopolysaccharides, which are present on the cell wall of gram-negative bacteria, activating the immune response. (Review) PMID: 25515751
  • genetic polymorphism is associated with asthma exacerbations in children PMID: 24902762
  • In monocytes of sepsis, MD-2 expression was found to be regulated by STAT1. PMID: 24858600
  • Substitution of hMD-2 residue V82 with an amino acid residue with a bulkier hydrophobic side chain enables activation of TLR4/MD-2. PMID: 25203747
  • This study suggests that genetic variants of LY96 may modulate the effect of smoking on carotid plaque burden. PMID: 24954085
  • overexpression of MD-2s led to marked reduction in markers of tissue injury and inflammation in models of lung inflammation PMID: 25576596
  • Purified monomeric ligand.MD-2 complexes reveal molecular and structural requirements for activation and antagonism of TLR4 by Gram-negative bacterial endotoxins. PMID: 24895101
  • Studies suggest that myeloid differentiation 2 (MD-2) as a therapeutic target for sepsis. PMID: 24896325
  • Mechanistically, engagement of MD-2 by PTX3-opsonized Aspergillus conidia activated the TLR4/Toll/IL-1R domain-containing adapter inducing IFN-beta-dependent signaling pathway converging on IL-10. PMID: 25049357
  • Collectively, these data showed for the first time that, HIV-1 Tat interacts physically with high affinity with TLR4-MD2 to promote proinflammatory cytokines (TNF-alpha) and the immunosuppressive cytokine IL-10 both. PMID: 24165011
  • Data suggest that zhankuic acid A (ZAA), which competes with LPS for binding to MD-2 as a TLR4/MD-2 antagonist, may be a potential therapeutic agent for gram-negative bacterial infections. PMID: 24532584
  • these findings indicate that MD-2 is involved in IFN-gamma signalling and IFN-gamma-augmented MMP-1 up-regulation by LPS. PMID: 23800176
  • Extracellular complex formation of TLR4 with secreted MD-2 was detectable using monoclonal antibodies. PMID: 24021278
  • both oral and enteric C. concisus strains upregulated expression of TLR4 and MD-2 in HT-29 cells. PMID: 23437263
  • Consistently, soluble TLR4 expressed without MD2 inhibited metal- but not LPS-induced responses, opening new therapeutic perspe PMID: 23059983
  • Respiratory syncytial virus F protein requires MD-2 for the induction of the TLR4-mediated inflammatory response. PMID: 22872782
  • In LOS.MD-2 complexes, one of the six fatty acyl chains of LOS is more susceptible to paramagnetic attenuation, suggesting protrusion of that fatty acyl chain from the hydrophobic pocket of MD-2, independent of association with TLR4. PMID: 22433852
  • Lipopolysaccharide cytokine response was efficiently and equally abolished by MD-2 and CD14 neutralization; the response induced by whole E. coli bacteria was only modestly reduced by MD-2 neutralization, whereas CD14 neutralization was more efficient. PMID: 21948372
  • have identified specific structural and dynamic features of the MD-2-endotoxin complexes that may control dimerization of TLR4 molecules. PMID: 21924775
  • The association between occupational endotoxin exposure and wheeze in agricultural workers was significantly modified by genetic variants in CD14 and MD2 PMID: 21389010
  • Data demonstrate that during bacterial infection, newborns amplify the TLR2-MyD88 pathway in G+ bacterial infection and the TLR4/MD2/MyD88 pathway in G- bacterial infection, implicating the innate immune pathway in response to bacterial infection. PMID: 20805788
  • higher expression levels in tissue from patients with colorectal cancer PMID: 20699280
  • Computational study of the interactions of the unmodified dendrimer, glucosamine, and of the partially glycosylated dendrimer with TLR4 and MD-2 using molecular docking and molecular dynamics techniques. PMID: 21738462
  • tyrosine phosphorylation of MD-2 is important for signaling following exposure to lipopolysaccharide PMID: 21918188
  • Cytokines can enhance TLR4 and MD-2 expressions and promote the reaction with LPS in intestinal epithelial cells. PMID: 20848773
  • Interferon-gamma-induced MD-2 protein expression and lipopolysaccharide (LPS) responsiveness in corneal epithelial cells is mediated by Janus tyrosine kinase-2 activation and direct binding of STAT1 protein to the MD-2 promoter. PMID: 21572044
  • In this study, we produced variants of MD-1 and MD-2 in Pichia pastoris. PMID: 21130168
  • Innate immune recognition of meningococcal capsular polysaccharides by macrophages can occur via TLR2- and TLR4-MD-2 pathways. PMID: 21191086
  • Neisserial lipooligosaccharides from different meningococcal and gonococcal strains have different potencies to activate NF-kappaappaB through the Toll-like receptor 4-MD-2 pathway in monocytes. PMID: 21037101
  • Data conclude that these gene variants in the MD-2 gene promoter region are not associated with tuberculosis, and apparently do not play a role in susceptibility to tuberculosis in the Chinese population. PMID: 20730709
  • species-specific activation of lipid IV(A) PMID: 20592019
  • increased expression in intestinal epithelial cells in patients with inflammatory bowel disease PMID: 19710105
  • In this study, we have identified a novel alternatively spliced isoform of human MD-2, termed MD-2 short (MD-2s), which lacks the region encoded by exon 2 of the MD-2 gene. PMID: 20435923
  • Polymorphisms of the promoter region of MD-2 gene at position - 1625 C/G is correlated with MODS and sepsis after severe trauma in Chinese Han population. PMID: 19209789
  • sMD-2 and sCD14 inhibit the growth of both Gram-positive and Gram-negative bacteria. PMID: 20377740
  • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    Recently viewed