Recombinant Human Ly6/Plaur Domain-Containing Protein 3 (LYPD3) Protein (His)

Beta LifeScience SKU/CAT #: BLC-02012P
Greater than 85% as determined by SDS-PAGE.
Greater than 85% as determined by SDS-PAGE.

Recombinant Human Ly6/Plaur Domain-Containing Protein 3 (LYPD3) Protein (His)

Beta LifeScience SKU/CAT #: BLC-02012P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human Ly6/Plaur Domain-Containing Protein 3 (LYPD3) Protein (His) is produced by our E.coli expression system. This is a full length protein.
Purity Greater than 85% as determined by SDS-PAGE.
Uniprotkb O95274
Target Symbol LYPD3
Synonyms GPI-anchored metastasis-associated protein C4.4A homolog (Matrigel-induced gene C4 protein) (MIG-C4)
Species Homo sapiens (Human)
Expression System E.coli
Tag N-10His
Target Protein Sequence LECYSCVQKADDGCSPNKMKTVKCAPGVDVCTEAVGAVETIHGQFSLAVRGCGSGLPGKNDRGLDLHGLLAFIQLQQCAQDRCNAKLNLTSRALDPAGNESAYPPNGVECYSCVGLSREACQGTSPPVVSCYNASDHVYKGCFDGNVTLTAANVTVSLPVRGCVQDEFCTRDGVTGPGFTLSGSCCQGSRCNSDLRNKTYFSPRIPPLVRLPPPEPTTVASTTSVTTSTSAPVRPTSTTKPMPAPTSQTPRQGVEHEASRDEEPRLTGGAAGHQDRSNSGQYPAKGGPQQPHNKGC
Expression Range 31-326aa
Protein Length Full Length of Mature Protein
Mol. Weight 37.1 kDa
Research Area Cancer
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Supports cell migration. May be involved in urothelial cell-matrix interactions. May be involved in tumor progression.
Subcellular Location Cell membrane; Lipid-anchor, GPI-anchor.
Database References

HGNC: 24880

OMIM: 609484

KEGG: hsa:27076

STRING: 9606.ENSP00000244333

UniGene: PMID: 29048672

  • Our results are consistent with previous data in mouse embryogenesis and wound healing. Based on these findings, we conclude that this human TES model provides an excellent surrogate for studies of C4.4A and Haldisin expressions in human stratified epithelia. PMID: 29075641
  • Expression and crystallographic studies of the D1D2 domains of C4.4A have been reported. PMID: 28777093
  • LYPD3 has a role in the maintenance of colorectal cancer stem-like cells. PMID: 28238780
  • Highly expressed C4.4A protein in HER2-positive human breast cancers indicate a good prognosis. PMID: 23918676
  • overexpression of C4.4A correlates with metastatic potential of gastric cancer and C4.4A could be a novel independent prognostic marker for predicting outcome. PMID: 24935570
  • expression of the Ly6/uPAR-domain proteins C4.4A and Haldisin in non-invasive and invasive skin lesions PMID: 25414274
  • Tenascin-C expression was significantly associated with C4.4A expression in clinical esophageal squamous carcinoma samples suggesting that there may be a functional role for the C4.4A to induceTenascin-C in vivo. PMID: 23708783
  • findings suggest that a tight association between C4.4A and tumor budding may, in part, be due to C4.4A promoting epithelial-mesenchymal transition at the invasive front of colorectal cancer PMID: 22404718
  • the first explanation for the C4.4A contribution to wound healing and metastasis. PMID: 22431918
  • data indicate that expression of the C4.4A protein at the invasive front acts as a novel prognostic marker in colorectal cancer, possibly through invasion-related mechanisms PMID: 20825414
  • hAG-2 and hAG-3, human homologues of genes involved in differentiation, are associated with oestrogen receptor-positive breast tumours and interact with metastasis gene C4.4a and dystroglycan PMID: 12592373
  • High tumour cell C4.4A expression is associated with shorter survival for non-small cell lung cancer patients. PMID: 17706320
  • Overexpression of C4.4A is associated with invasion and metastasis of esophageal squamous cell carcinoma PMID: 17849475
  • we consider C4.4A as a candidate diagnostic marker in colorectal cancer, which possibly can be detected in body fluids PMID: 17912244
  • cleavage of C4.4A by ADAM10 and ADAM17 contributes to tumor progression PMID: 18979631
  • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    Recently viewed