Recombinant Human LTBR Protein (N-6xHis)
Beta LifeScience
SKU/CAT #: BLC-11406P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human LTBR Protein (N-6xHis)
Beta LifeScience
SKU/CAT #: BLC-11406P
Regular price
$94900
$949.00
Sale price$24000
$240.00Save $709
/
Submit an inquiry or email sales for a custom bulk quote. Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
| Description | Amino acids 31-224 form the expressed segment for recombinant Human LTBR. This LTBR protein is theoretically predicted to have a molecular weight of 25.4 kDa. This LTBR protein is produced using e.coli expression system. The N-terminal 6xHis tag was fused into the coding gene segment of LTBR, making it easier to detect and purify the LTBR recombinant protein in the later stages of expression and purification.The human tumor necrosis factor receptor superfamily member 3 (LTBR), belonging to the tumor necrosis factor receptor (TNFR) superfamily is a cell surface receptor involved in immune system regulation. LTBR plays a critical role in the activation of the non-canonical NF-κB signaling pathway. LTBR is primarily expressed in B cells, dendritic cells, and certain T cells. Upon binding to its ligand, lymphotoxin alpha/beta (LTα/β), LTBR triggers signaling cascades that modulate immune responses, including the development and organization of lymphoid tissues, such as lymph nodes and spleen. Research on LTBR explores its functions in immune regulation, lymphoid tissue development, and its implications in inflammatory and autoimmune diseases. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P36941 |
| Target Symbol | LTBR |
| Species | Human |
| Expression System | E.coli |
| Tag | N-terminal 6xHis-tagged |
| Target Protein Sequence | QAVPPYASENQTCRDQEKEYYEPQHRICCSRCPPGTYVSAKCSRIRDTVCATCAENSYNEHWNYLTICQLCRPCDPVMGLEEIAPCTSKRKTQCRCQPGMFCAAWALECTHCELLSDCPPGTEAELKDEVGKGNNHCVPCKAGHFQNTSSPSARCQPHTRCENQGLVEAAPGTAQSDTTCKNPLEPLPPEMSGT |
| Expression Range | 31-227aa |
| Protein Length | Extracellular Domain |
| Mol. Weight | 25.4kDa |
| Research Area | Epigenetics and Nuclear Signaling |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Target Function | Receptor for the heterotrimeric lymphotoxin containing LTA and LTB, and for TNFS14/LIGHT. Promotes apoptosis via TRAF3 and TRAF5. May play a role in the development of lymphoid organs. |
| Subcellular Location | Membrane; Single-pass type I membrane protein. |
| Database References |
HGNC: 6718 OMIM: 600979 KEGG: hsa:4055 STRING: 9606.ENSP00000228918 UniGene: Hs.1116 |
