Recombinant Human Low Molecular Weight Phosphotyrosine Protein Phosphatase (ACP1)
Beta LifeScience
SKU/CAT #: BLC-07983P
Greater than 90% as determined by SDS-PAGE.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ACP1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ACP1.
Recombinant Human Low Molecular Weight Phosphotyrosine Protein Phosphatase (ACP1)
Beta LifeScience
SKU/CAT #: BLC-07983P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Low Molecular Weight Phosphotyrosine Protein Phosphatase (ACP1) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P24666 |
| Target Symbol | ACP1 |
| Synonyms | Acid phosphatase 1 soluble; Acid phosphatase of erythrocyte ; ACP1; Adipocyte acid phosphatase; Cytoplasmic phosphotyrosyl protein phosphatase; HAAP; LMW-PTP; LMW-PTPase; Low molecular weight cytosolic acid phosphatase; Low molecular weight phosphotyrosine protein phosphatase; PAP1; PAP2; phosphatase; acid; of erythrocyte; PPAC_HUMAN; Protein tyrosine phosphatase; PTPase; Purple acid phosphatase; Red cell acid phosphatase 1; testicular secretory protein Li 37 |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | Tag-Free |
| Target Protein Sequence | MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIPMSHVARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH |
| Expression Range | 1-158aa |
| Protein Length | Full Length |
| Mol. Weight | 18.0 kDa |
| Research Area | Cell Biology |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Acts on tyrosine phosphorylated proteins, low-MW aryl phosphates and natural and synthetic acyl phosphates. Isoform 3 does not possess phosphatase activity. |
| Subcellular Location | Cytoplasm. |
| Protein Families | Low molecular weight phosphotyrosine protein phosphatase family |
| Database References | HGNC: 122 OMIM: 171500 KEGG: hsa:52 STRING: 9606.ENSP00000272065 UniGene: PMID: 28668716 |
