Recombinant Human Lipopolysaccharide-Binding Protein (LBP) Protein (His-GST&Myc)

Name: Recombinant Human Lipopolysaccharide-Binding Protein (LBP) Protein (His-GST&Myc)
Brand: Beta LifeScience
SKU: BLC-01199P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Lipopolysaccharide-Binding Protein (LBP) Protein (His-GST&Myc) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	P18428
Target Symbol	LBP
Synonyms	(LBP)
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-10His-GST&C-Myc
Target Protein Sequence	TDDMIPPDSNIRLTTKSFRPFVPRLARLYPNMNLELQGSVPSAPLLNFSPGNLSVDPYMEIDAFVLLPSSSKEPVFRLSVATNVSATLTFNTSKITGFLKPGKVKVELKES
Expression Range	304-414aa
Protein Length	Partial
Mol. Weight	47.4 kDa
Research Area	Immunology
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Plays a role in the innate immune response. Binds to the lipid A moiety of bacterial lipopolysaccharides (LPS), a glycolipid present in the outer membrane of all Gram-negative bacteria. Acts as an affinity enhancer for CD14, facilitating its association with LPS. Promotes the release of cytokines in response to bacterial lipopolysaccharide.
Subcellular Location	Secreted. Cytoplasmic granule membrane.
Protein Families	BPI/LBP/Plunc superfamily, BPI/LBP family
Database References	HGNC: 6517 OMIM: 151990 KEGG: hsa:3929 STRING: 9606.ENSP00000217407 UniGene: PMID: 29494603 Serum LBP levels are associated with arterial stiffness, independent of obesity and traditional cardiovascular risk factors, especially in men with type 2 diabetes. PMID: 28486964 novel observation that sCD14 compared with lipopolysaccharide binding protein, offers a preferred target to ameliorate TLR especially TLR4-induced inflammation and insulin resistance in human obesity and metabolic syndrome PMID: 26880233 LBP, an endotoxemia associated protein might be used as an inflammatory biomarker of both infectious and non-infectious origins in HCV-infected subjects PMID: 28107471 Data show that after matching for gender, age, and body mass index (BMI), serum lipopolysaccharide-binding protein (LBP) does not improve prediction of the development of type 2 diabetes mellitus (T2DM) independently. PMID: 25753130 The main findings of this study are that, in acute stroke patients, levels of LBP, IL-10, IL-6 and CRP show a different time course in patients with and without post-stroke infection. PMID: 25613713 Serum LBP level is significantly elevated in polycystic ovary syndrome women and is associated with insulin resistance. PMID: 26799617 LBP serves not only as an extracellular LPS shuttle but in addition facilitates intracellular transport of LPS. PMID: 26804480 LBP level was not significantly different in neutropenic systemic inflammatory response syndrome patients and sepsis patients. PMID: 26046926 Report increased secretion of Fetuin A, LBP and HMGB-1 from subcutaneous adipose tissue in metabolic syndrome. PMID: 25978344 Low levels of microbial translocation marker LBP are associated with sustained viral response after anti-HCV treatment in HIV-1/HCV co-infected patients PMID: 25785448 serum level elevated in late-onset neonatal sepsis in very low birth weight infants PMID: 25014514 Adjusting for body mass index and waist circumference, LBP levels remained significantly increased in metabolic syndrome and increased with increasing numbers of MetS risk factors. PMID: 25063948 study suggested that elevated plasma LBP was associated with an increased risk of developing MetS among middle-aged and older Chinese, especially in normal-weight individuals. PMID: 24906952 In preterm neonates born to asymptomatic women with PPROM, LBP in cord blood at delivery is an excellent diagnostic biomarker of Fetal inflammatory response syndrome/funisitis with prognostic potential. PMID: 24335151 report pre-ART IL-6 and LBP levels as well as IL-6, LBP and I-FABP levels during IRIS-event as potential biomarkers in TB-IRIS PMID: 24312369 In childnre, LBP was independently associated with BMI and with measures of obstructive sleep apnea severity as well as with metabolic dysfunction, particularly insulin resistance as indicated by the homeostasis model assessment of insulin resistance. PMID: 24276451 Suggest that the serum LBP concentration constitutes a reliable biologic marker for the diagnosis of a febrile urinary tract infection in children. PMID: 23463341 Mutations in the lipopolysaccharide binding protein impair innate immunity. PMID: 24120359 Serum LBP concentrations increased with age. Overweight, obesity, and having metabolic syndrome (particularly, low HDL cholesterol levels) were associated with higher LBP concentrations PMID: 23349936 expression in oral keratinocytes is stimulated by Porphyromonas gingivalis LPS PMID: 22736337 Human lipopolysaccharide-binding protein (LBP) and CD14 independently deliver triacylated lipoproteins to Toll-like receptor 1 (TLR1) and TLR2 and enhance formation of the ternary signaling complex PMID: 23430250 LBP is a surrogate marker of microbial translocation in association with physical functioning of older adults. PMID: 22960476 Association of lipopolysaccharide-binding protein gene polymorphisms with cerebral infarction in a Chinese population PMID: 22476641 our study demonstrated that an elevated LBP level of >15000 ng/ml may serve as a biomarker for the prediction and monitoring of aGVHD. PMID: 22552880 During the first 14 days of postoperative sepsis, LBP plasma concentrations showed a time course that was very similar to CRP with a high concordance in the pattern of day-to-day changes PMID: 21901123 The availability of commercial methods for the automated measurement of the soluble CD14 subtype presepsin and lipopolysaccharide binding protein represent a challenge for the evaluation in clinical practice of reliable markers of neonatal sepsis. PMID: 21740312 Aseptic trauma primes the innate immune system for the posttraumatic release of lipopolysaccharide binding protein and sCD14 PMID: 21722015 Cytokine concentrations in amniotic fluid during the mid-trimester did not differ with parity or fetal gender. IL-6, IL-8, and LBP levels appeared stable with gestational week (GW), whereas GW significantly influenced TNF-alpha concentrations. PMID: 21702700 LBP measurements performed shortly after preterm premature rupture of membranes, are not of value either in the prediction of newborn's infection, or in the prognosis of latency period duration. PMID: 21353369 This study highlights the LBP rs2232596 and CD14 rs4914 polymorphisms as biomarkers for elevated colorectal carcinoma susceptibility in the Chinese Han population PMID: 21633598 High LBP is associated with Crohn's disease. PMID: 20865702 Elevated circulating LBP was associated with obesity, metabolic syndrome, and type 2 diabetes in apparently healthy Chinese. PMID: 20530747 The association of the polymorphisms c.291C>T and c.613A>G suggest a role of LBP in the disease manifestation of infective endocarditis. PMID: 19560454 Serial LBP serum measurements may offer a clinically useful biomarker for identification of patients with severe sepsis having the worst outcomes and the highest probability of developing sepsis-induced ARDS PMID: 19718443 carboxyl-terminal domain of these closely related endotoxin-binding proteins dictates the route and host responses to complexes they form with endotoxin. PMID: 11773072 a new and reliable infection marker after kidney transplantation PMID: 11976738 Identification of single amino acid residues essential for the binding of lipopolysaccharide (LPS) to LPS binding protein (LBP) residues 86-99 by using an Ala-scanning library PMID: 11991204 plasma factor LBP and cell surface receptor CD14 were necessary for LPS activation of p38, which was tightly associated with LPS priming of the PMN respiratory burst PMID: 12117913 Besides a role in the detoxification of bacterial toxin present in the circulation, LBP-chylomicron complexes may be part of a local defense mechanism of the intestine against translocated bacterial toxin. PMID: 12538700 innate immune recognition of LTA via LBP, CD14, and TLR-2 represents an important mechanism in the pathogenesis of systemic complications in the course of infectious diseases brought about by Gram-positive pathogens. while TLR-4 and MD-2 are not involved. PMID: 12594207 Single nucleotide polymorphism of the LBP gene is not assciated with complicated sepsis after trauma. PMID: 12615620 data support the hypothesis that lipopolysaccharide binding protein can inhibit cell responses to lipopolysaccharide(LPS) by inhibiting LPS transfer from membrane CD14 to the Toll-like receptor 4-MD-2 signaling receptor PMID: 12754215 plays an essential role in the innate immune response to Gram-positive pneumococci PMID: 12932360 In critically ill neonates aged over 48 h and children lipopolysaccharide binding protein is a better marker than procalcitonin, interleukin-6 and C-reactive protein. PMID: 15127192 Dual role of LBP and CD14 in initiation of proinflammatory signaling and clearance or neutralization of LPS. PMID: 15618154 studies suggest that SP-A could contribute to modulate Re-LPS responses by altering the competence of the LBP-CD14 receptor complex PMID: 15932345 LBP mediates the fusion of lipid membranes and LPS aggregates. PMID: 16303759 Human pulmonary LBP acts as an important modulator of the LPS response in the respiratory tract in vivo. PMID: 16493079 Significantly elevated serum concentrations of LBP and sCD14 are found in severe sepsis patients. PMID: 16512634

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.