Recombinant Human Lim Domain Transcription Factor Lmo4 (LMO4) Protein (GST)

Name: Recombinant Human Lim Domain Transcription Factor Lmo4 (LMO4) Protein (GST)
Brand: Beta LifeScience
SKU: BLC-09205P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Product Overview

Description	Recombinant Human Lim Domain Transcription Factor Lmo4 (LMO4) Protein (GST) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P61968
Target Symbol	LMO4
Synonyms	Breast tumor autoantigen; LIM domain only 4; LIM domain only protein 4; LIM domain transcription factor LMO 4; LIM domain transcription factor LMO4; LMO 4; LMO-4; LMO4; LMO4_HUMAN; OTTHUMP00000011905; OTTHUMP00000011906
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-GST
Target Protein Sequence	MVNPGSSSQPPPVTAGSLSWKRCAGCGGKIADRFLLYAMDSYWHSRCLKCSCCQAQLGDIGTSCYTKSGMILCRNDYIRLFGNSGACSACGQSIPASELVMRAQGNVYHLKCFTCSTCRNRLVPGDRFHYINGSLFCEHDRPTALINGHLNSLQSNPLLPDQKVC
Expression Range	1-165aa
Protein Length	Full Length
Mol. Weight	45.0kDa
Research Area	Epigenetics And Nuclear Signaling
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Probable transcriptional factor.
Database References	HGNC: 6644 OMIM: 603129 KEGG: hsa:8543 STRING: 9606.ENSP00000359573 UniGene: Hs.436792

Gene Functions References

Lmo4 participates in the regulation of lung epithelial cell proliferation but is not essential for tumor progression. PMID: 26048572
LMO4 appears to form a hub in protein-protein interaction networks, linking numerous pathways within cells. PMID: 25310299
Clim2, in a complex with LMO4, supports mammary stem cells by directly targeting the Fgfr2 promoter in basal cells to increase its expression PMID: 25079073
Existence of a region in the lateral portion of the mammalian cochlea that is competent to make an organ of Corti is demonstrated in the absence of LMO4 function. PMID: 25057208
Low LMO4 mRNA levels were associated with response to erlotinib in non-small-cell lung cancer. PMID: 23407556
oncoprotein HBXIP is able to activate the transcriptional coregulatory protein LMO4 through transcription factor Sp1 in promotion of proliferation of breast cancer cells. PMID: 23291272
Data suggest that overexpression of LMO4 may disrupt some of the normal tumour suppressor activities of CtIP, thereby contributing to breast cancer progression. PMID: 23353824
the association of high levels of LMO4 with aggressive neuroblastomas is dependent on LMO4 regulation of cadherin expression and hence, tumor invasiveness PMID: 23407937
LMO4 is a direct target of p53 and inhibits p53-mediated proliferative inhibition of breast cancer cells through interacting p53 PMID: 22906635
LMO4 is over-expressed in highly invasive rhabdomyosarcoma, alveolar cells PMID: 21271214
LMO4 expression in squamous cell carcinoma of the anterior tongue PMID: 21362019
data indicate that LMO4 has similar cellular effects in normal mammary epithelial cells and breast cancer cells, and also provide direct evidence for the idea that normal development and carcinogenesis share conserved molecular mechanisms PMID: 20526802
LMO4 protects neurons from ischemic brain injury, in part through its requirement as an essential cofactor of PPAR gamma PMID: 19020036
These findings reveal a novel complex between BRCA1, LMO4, and CtIP and indicate a role for LMO4 as a repressor of BRCA1 activity in breast tissue. PMID: 11751867
1H, 15N and 13C assignments of FLIN4, an intramolecular LMO4:ldb1 complex PMID: 12153047
Lmo4 RNA overexpression interferes with neuritic outgrowth,anti-sense Lmo4 RNA expression favors neuritogenesis in SH-SY5Y cells. Changes in Lmo4 RNA expression levels might alter the rate of neuritic outgrowth in the developing and adult nervous system. PMID: 12877980
LMO4 interaction modulates the interleukin-6 receptor subunit glycoprotein 130 complex and its signaling PMID: 15677447
LMO4 is consistently more highly expressed in the embryonic right perisylvian cerebral cortex than in the left PMID: 15894532
LMO4 in breast epithelium contributes directly to breast neoplasia by altering the rate of cellular proliferation and promoting cell invasion. PMID: 15897450
Artificial intramolecular cyclic protein complex between two interacting proteins: the largely unstable LIM-only protein 4 (LMO4) and an unstructured domain of LIM domain binding protein 1 (ldb1). PMID: 17001033
In this study, patients whose tumours exhibited high LMO4 expression had a significant survival advantage following operative resection PMID: 18231110
Results suggested that LMO4 is overexpressed at late stages in carcinogenesis of pancreatic cancer. PMID: 19099607
Lmo4 expression coincides with the timing of the development of the somatosensory barrel field. PMID: 19111533
LMO4 is a novel cell cycle regulator with a key role in mediating ErbB2-induced proliferation, a hallmark of ErbB2-positive disease. PMID: 19648968

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.