Recombinant Human Leukocyte Cell-Derived Chemotaxin 1 (CNMD) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-08198P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Leukocyte Cell-Derived Chemotaxin 1 (CNMD) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-08198P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Leukocyte Cell-Derived Chemotaxin 1 (CNMD) Protein (His-SUMO) is produced by our E.coli expression system. This is a protein fragment. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | O75829 |
| Target Symbol | CNMD |
| Synonyms | BRICD3; BRICHOS domain containing 3; CH-SP; CHM I; ChM-I; CHM1; chondromodulin; Chondromodulin I; Chondromodulin-1; Chondromodulin-I; Chondrosurfactant protein; LECT 1; Lect1; LECT1_HUMAN; Leukocyte cell derived chemotaxin 1; Multiple myeloma tumor suppressor 1; MYETS1 |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-6His-SUMO |
| Target Protein Sequence | EVVRKIVPTTTKRPHSGPRSNPGAGRLNNETRPSVQEDSQAFNPDNPYHQQEGESMTFDPRLDHEGICCIECRRSYTHCQKICEPLGGYYPWPYNYQGCRSACRVIMPCSWWVARILGMV |
| Expression Range | 215-334aa |
| Protein Length | Partial |
| Mol. Weight | 29.8kDa |
| Research Area | Cancer |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Bifunctional growth regulator that stimulates the growth of cultured chondrocytes in the presence of basic fibroblast growth factor (FGF) but inhibits the growth of cultured vascular endothelial cells. May contribute to the rapid growth of cartilage and vascular invasion prior to the replacement of cartilage by bone during endochondral bone development. Inhibits in vitro tube formation and mobilization of endothelial cells. Plays a role as antiangiogenic factor in cardiac valves to suppress neovascularization. |
| Subcellular Location | [Chondromodulin-1]: Secreted, extracellular space, extracellular matrix. Note=Accumulated in the inter-territorial matrix of cartilage.; [Chondrosurfactant protein]: Endomembrane system; Single-pass membrane protein. |
| Protein Families | Chondromodulin-1 family |
| Database References | HGNC: 17005 OMIM: 605147 KEGG: hsa:11061 STRING: 9606.ENSP00000367198 UniGene: PMID: 28983591 |
![SDS-PAGE analysis of Human NDUFV1 (Nadh Dehydrogenase [Ubiquinone] Flavoprotein 1, Mitochondrial) - Recombinant Protein, CAT# BLT-08321P, showing >90% purity under 15% SDS-PAGE (Reduced)](http://www.betalifesci.com/cdn/shop/files/1ihmbkjr21vdmc6j_{width}x.jpg?v=1753363793)
