Recombinant Human Leukemia Inhibitory Factor (LIF), Active

Name: Recombinant Human Leukemia Inhibitory Factor (LIF), Active
Brand: Beta LifeScience
SKU: BLC-05934P
Availability: InStock

Greater than 95% as determined by SDS-PAGE.

Collections: Buy cytokines, chemokines, and growth factors for research online, Growth factors and receptors for advanced research, High-quality cytokines for advanced research, High-quality recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Leukemia Inhibitory Factor (LIF), Active is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 95% as determined by SDS-PAGE.
Endotoxin	Less than 1.0 EU/μg as determined by LAL method.
Activity	The ED50 as determined by the M1 cell differentiation assay is less than 0.8 ng/ml
Uniprotkb	P15018
Target Symbol	LIF
Synonyms	CDF; Cholinergic Differentiation Factor ; D factor; DIA; Differentiation inducing factor; differentiation inhibitory activity; Differentiation stimulating factor; Differentiation-stimulating factor; Emfilermin ; Hepatocyte stimulating factor III; HILDA; Human interleukin in DA cells; Leukemia inhibitory factor; LIF; LIF_HUMAN; Melanoma derived LPL inhibitor; Melanoma-derived LPL inhibitor; MLPLI
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	Tag-Free
Complete Sequence	SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF
Expression Range	23-202aa
Protein Length	Full Length of Mature Protein
Mol. Weight	19.7 kDa
Research Area	Cancer
Form	Liquid or Lyophilized powder
Buffer	Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.

Target Details

Target Function	LIF has the capacity to induce terminal differentiation in leukemic cells. Its activities include the induction of hematopoietic differentiation in normal and myeloid leukemia cells, the induction of neuronal cell differentiation, and the stimulation of acute-phase protein synthesis in hepatocytes.
Subcellular Location	Secreted.
Protein Families	LIF/OSM family
Database References	HGNC: 6596 OMIM: 159540 KEGG: hsa:3976 STRING: 9606.ENSP00000249075 UniGene: PMID: 29605252 The findings indicate that low LIF concentrations in serum and follicular fluid may contribute to disordered folliculogenesis in polycystic ovary syndrome. PMID: 29397316 This study uses LIF to activate the PI3K/ AKT signal and induce the anti-inflammatory effect during the neuron differentiation from human induced pluripotent stem cell-derived neural precursor cells. PMID: 29393372 These findings implicate ZEB1 as a stem cell regulator in glioma via LIF repression which when deleted leads to increased stemness, tumorigenicity and shortened patient survival. PMID: 28246407 Decreased serum LIF levels may be associated with vasculopathy in systemic sclerosis (SSc) and that Fli1 deficiency may contribute to the inhibition of LIF-dependent biological effects on SSc endothelial cells by suppressing the expression of LIF, LIF receptor, and gp130. PMID: 29038846 The endometrial expression of LIF and CD34 in the pathogenesis of non-developing pregnancy can be used for evaluating the pregnancy prognosis in women of young and old reproductive age. PMID: 29063331 This report describes the involvement of proteins responsible for cell growth and progression and defines the LIF-mediated novel autocrine-paracrine signaling loop for cell growth arrest. PMID: 28755912 The expression of LIF was associated with tumor size and a poorer overall survival. Microarray and quantitative real-time polymerase chain reaction assessments suggest that LIF can facilitate tumor-promoting inflammation. Results indicate that LIF plays a role in maintaining cancer stem cells in chordomas. PMID: 28247842 study indicated impaired LIF expression levels only in women with unexplained infertility, while LIF-R expression was impaired in all sub-groups of infertile women. PMID: 28432985 findings illustrate that DeltaNp63alpha can inhibit the levels of LIF mRNA by direct transcription regulation and decrease LIF mRNA stability by suppressing the expression of Lnc-LIF-AS. An inverse interaction of LIF and DeltaNp63alpha expression was as well validated in clinical samples of cervical cancer, and high level of LIF in cervical cancers was related with poor patient survival. PMID: 28391028 ATF3 plays a significant role in regulating human endometrial receptivity and embryo attachment in vitro via up-regulation of leukemia inhibitory factor. PMID: 28577574 Although further studies would be required to deconvolute the targets involved in LIF induction and to confirm activity of hits in more disease-relevant assays, our results have demonstrated the potential of the phenotypic approach to identify specific and chemically tractable small molecules that trigger the production of LIF in relevant cell lines PMID: 26984928 SNP 3951C/T of LIF may not be associated with in vitro fertilization and embryo transfer outcome in Iranian population. PMID: 28466814 In summary, this study has shown that LIF is implicated in the HG-mediated inhibition of osteoblast differentiation, via promoting STAT3/SOCS3 signaling. This study may provide insights into the signal pathway of HG-induced bone loss or delayed injured joint healing. PMID: 28064096 Cytokines of the LIF/CNTF family and metabolism PMID: 26817395 These results demonstrate the involvement of PIM kinases in LIF-induced regulation in different trophoblastic cell lines which may indicate similar functions in primary cells. PMID: 28729093 Data suggest a 216-nucleotide proximal cis-element in LIF mRNA exhibits mRNA destabilizing potential; on exposure to carcinogen PMA (phorbol-12-myristate-13-acetate), this cis-element exhibits mRNA stabilizing activity. PMA induces nucleo-cytoplasmic translocation of both nucleolin and PCBP1, 2 trans-acting factors that bind to and stabilize LIF mRNA. [LIF = leukemia inhibitory factor; PCBP1 = poly(rC) binding protein 1] PMID: 28512205 Leukemia inhibitory factor (LIF) - STAT3 transcription factor (STAT3) signaling pathway is systemically dysregulated in in the endometrium of patients with recurrent/repeated implantation failure (RIFE). PMID: 27304912 Endometrial expression of LIF and LIFR is significantly reduced in the epithelial cells of infertile women. PMID: 27082016 LIF SNP T/G (rs929271) seems to be a susceptibility biomarker capable of predicting implantation efficiency and pregnancy outcomes. PMID: 26615902 Overexpression of LIF promotes Epithelial-mesenchymal transition and results in cancer. PMID: 26716902 This review discusses the role of LIF and the recent analysis of its action on the uterine LE in regulating endometrial receptivity and implantation. PMID: 26817565 Women with dormant genital tuberculosis were found to have decreased endometrial LIF-STAT3 signaling. PMID: 26776907 Data show that leukemia inhibitory factor (LIF) signaling promote chemoresistance in cholangiocarcinoma by up-regulating myeloid cell factor-1 (Mcl-1) via phosphatidylinositol 3-kinase (PI3K)/c-akt protein (AKT)-dependent pathway. PMID: 26296968 Despite common signal transduction mechanisms (JAK/STAT, MAPK and PI3K) LIF can have paradoxically opposite effects in different cell types including stimulating or inhibiting each of cell proliferation, differentiation and survival. PMID: 26187859 Taken together, we firstly demonstrate that LIF enhances the adhesion of trophoblastic cells to endometrial cells by up-regulating expression of integrin heterodimer alphaVbeta3 and alphaVbeta5. PMID: 26723254 LIF has a role in negatively regulating tumour-suppressor p53 through Stat3/ID1/MDM2 in colorectal cancers PMID: 25323535 LIF/p21 signaling cascade as a novel tumor suppressive-like pathway in melanoma, acting downstream of TGFbeta to regulate cell cycle arrest and cell death, further highlight new potential therapeutic strategies for the treatment of cutaneous melanoma PMID: 25885043 LIF was frequently overexpressed in osteosarcoma, which could promote the growth and invasion through activating the STAT3 pathway. PMID: 26271643 LIF structure, signaling pathway, and primary roles in the development and function of an organism are reviewed--{REVIEW} PMID: 25879318 LIF downregulates the autoimmune response by enhancing Treg numbers. PMID: 25514345 LIF mediates fibroblast activation to promote invasive tumor microenvironment. PMID: 24857661 Data indicate that NanoLuc-fusion strategy provided an efficient approach for preparation of recombinant leukemia inhibitory factor (LIF) protein PMID: 25179300 Expression of LIF protects the lung from lung injury and enhanced pathology during respiratory syncytial virus infection. PMID: 25277705 Studied the association of tubal pregnancy with leukemia inhibitory factor (LIF) and leukemia inhibitory factor receptor (LIFR) expression in oviduct tissues. PMID: 25790555 an essential function of Foxm1 in the LIF/Stat3-mediated mESC self-renewal and the generation of iPSCs PMID: 24743237 Results show that endogenous levels of Pkig reciprocally regulate osteoblast and adipocyte differentiation and that this reciprocal regulation is mediated in part by LIF. PMID: 23963683 An increased mRNA expression of PROK1 and LIF could be one of the several abnormalities characterizing the endometrium in women recurrent pregnancy loss. PMID: 25128195 Addition of leukemia inhibitory factor (LIF) neutralizing antibodies inhibited oligodendrocyte differentiation, indicating a crucial role of TNFR2-induced astrocyte derived LIF for oligodendrocyte maturation PMID: 24310780 Data from 3-year-old girl and other reported cases support model in which abundance of LIF in B-cell acute lymphoblastic leukemia results in leukemic infiltration of central nervous system and development of Cushing syndrome. [CASE STUDY; REVIEW] PMID: 23729555 This mini review will summarize the findings that are related to LIF signaling and discuss the neuroprotective effects of LIF in different models. PMID: 24664722 Data suggest LIF/LIF receptor (alpha subunit) signal transduction facilitates blastocyst implantation or development of tubal pregnancy by stimulating blastocyst adhesion and outgrowth/proliferation of placenta or Fallopian tube epithelial cells. PMID: 24074901 Polyethylene glycated leukemia inhibitory factor antagonist inhibits human blastocyst implantation and triggers apoptosis by down-regulating embryonic AKT1. PMID: 23876532 NPC patients had increased serum levels of LIF. Higher LIF levels correlated with local tumor recurrence. Xenograft mouse studies showed that LIF critically contributes to NPC tumor growth & radioresistance. PMID: 24270418 study found lower expression of LIF in the edndometrium in unexplained infertile women with multiple implantation failures compared to fertile women; data suggest that the initial lower expression of LIF in proliferative phase may be one of the causes for multiple failure of implantation PMID: 23541977 novel expression and purification protocol for the production of recombinant hLIF PMID: 23628981 In summary, we can show that LIF is an important factor in melanoma progression. PMID: 23831429 Data show that the expressions of ER-alpha, PR, LIF, VEGF, iNOS and CB1 in fallopian tube and chorionic villi of tubal pregnancy were not altered by exposure to levonorgestrel emergency contraception. PMID: 23687977 LIF is a contraction-induced myokine, potentially acting in an autocrine or paracrine fashion to promote skeletal muscle satellite cell proliferation. PMID: 21527666 No correlation was found between pinopodes development stage and LIF expressions in endometrium. PMID: 22252755

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.