Recombinant Human Leucine-Rich Repeat-Containing G-Protein Coupled Receptor 4 (LGR4) Protein (His)

Name: Recombinant Human Leucine-Rich Repeat-Containing G-Protein Coupled Receptor 4 (LGR4) Protein (His)
Brand: Beta LifeScience
SKU: BLC-07572P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Leucine-Rich Repeat-Containing G-Protein Coupled Receptor 4 (LGR4) Protein (His) is produced by our Baculovirus expression system. This is a protein fragment.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	Q9BXB1
Target Symbol	LGR4
Synonyms	(G-protein coupled receptor 48)
Species	Homo sapiens (Human)
Expression System	Baculovirus
Tag	C-6His
Target Protein Sequence	APPLCAAPCSCDGDRRVDCSGKGLTAVPEGLSAFTQALDISMNNITQLPEDAFKNFPFLEELQLAGNDLSFIHPKALSGLKELKVLTLQNNQLKTVPSEAIRGLSALQSLRLDANHITSVPEDSFEGLVQLRHLWLDDNSLTEVPVHPLSNLPTLQALTLALNKISSIPDFAFTNLSSLVVLHLHNNKIRSLSQHCFDGLDNLETLDLNYNNLGEFPQAIKALPSLKELGFHSNSISVIPDGAFDGNPLLRTIHLYDNPLSFVGNSAFHNLSDLHSLVIRGASMVQQFPNLTGTVHLESLTLTGTKISSIPNNLCQEQKMLRTLDLSYNNIRDLPSFNGCHALEEISLQRNQIYQIKEGTFQGLISLRILDLSRNLIHEIHSRAFATLGPITNLDVSFNELTSFPTEGLNGLNQLKLVGNFKLKEALAAKDFVNLRSLSVPYAYQCCAFWGCDSYANLNTEDNSLQDHSVAQEKGTADAANVTSTLENEEHSQIIIHCTPSTGAFKPCEYLLGSWMIRLT
Expression Range	25-544aa
Protein Length	Partial
Mol. Weight	62.8 kDa
Research Area	Signal Transduction
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Receptor for R-spondins that potentiates the canonical Wnt signaling pathway and is involved in the formation of various organs. Upon binding to R-spondins (RSPO1, RSPO2, RSPO3 or RSPO4), associates with phosphorylated LRP6 and frizzled receptors that are activated by extracellular Wnt receptors, triggering the canonical Wnt signaling pathway to increase expression of target genes. In contrast to classical G-protein coupled receptors, does not activate heterotrimeric G-proteins to transduce the signal. Its function as activator of the Wnt signaling pathway is required for the development of various organs, including liver, kidney, intestine, bone, reproductive tract and eye. May also act as a receptor for norrin (NDP), such results however require additional confirmation in vivo. Required during spermatogenesis to activate the Wnt signaling pathway in peritubular myoid cells. Required for the maintenance of intestinal stem cells and Paneth cell differentiation in postnatal intestinal crypts. Acts as a regulator of bone formation and remodeling. Involved in kidney development; required for maintaining the ureteric bud in an undifferentiated state. Involved in the development of the anterior segment of the eye. Required during erythropoiesis. Also acts as a negative regulator of innate immunity by inhibiting TLR2/TLR4 associated pattern-recognition and proinflammatory cytokine production. Plays an important role in regulating the circadian rhythms of plasma lipids, partially through regulating the rhythmic expression of MTTP.
Subcellular Location	Cell membrane; Multi-pass membrane protein.
Protein Families	G-protein coupled receptor 1 family
Database References	HGNC: 13299 OMIM: 166710 KEGG: hsa:55366 STRING: 9606.ENSP00000368516 UniGene: PMID: 28220828 Luciferase reporter assay was performed to confirm that LGR4 is a direct target gene of miR-137 with a potential binding site in the 3'UTR of LGR4. PMID: 29786747 the host protein leucine-rich repeat-containing G protein-coupled receptor 4 (Lgr4) is essential for VSV and VSV-G pseudotyped lentivirus (VSVG-LV) to infect susceptible cells. PMID: 28842478 High LGR4 expression is associated with osteoarthritis. PMID: 28777797 Data (including data from studies using transgenic/knockout mice) suggest that LGR4 is key protein necessary for prostate cancer epithelial-mesenchymal transition and metastasis; LGR4 expression is elevated in human prostate cancer cell lines with metastatic potential; LGR4 silencing in prostate cancer cell line impairs cell migration and invasion without affecting cell proliferation. PMID: 28768769 LGR4 is another receptor for RANKL. LGR4 competes with RANK to bind RANKL and suppresses canonical RANK signaling during osteoclast differentiation. PMID: 27064449 The LGR4 A750T variant is correlated with central obesity-related characteristics in young subjects. PMID: 27925416 Lgr4 is a critical positive factor for skin tumorigenesis by mediating the activation of MEK1/ERK1/2 and Wnt/beta-catenin pathways. PMID: 27693558 miR-34a gene expression upregulation inhibits ARPE-19 cell proliferation, migration and adhesion partly by suppressing LGR4 expression. PMID: 27977785 Lgr4 activates Jmjd2a/AR signaling pathway to promote interaction AR with PSA promoter, causing reduction of prostate cancer apoptosis and cell cycle arrest. PMID: 27743893 A mechanistic understanding of RANKL-LGR4 interaction has provided new insight into LGR4 mediated RANKL signaling in osteoporosis and other diseases PMID: 27178473 miR-218 directly targets LGR4 and modulated the PI3K/Akt and Wnt/beta-catenin pathways in the LNCaP-IL-6+ cells. PMID: 26986507 LGR4 promotes tumorigenesis of prostate cancer via PI3K/Akt signaling pathway. PMID: 25636507 These findings suggest that aberrant RSPO3-LGR4 signaling potentially acts as a driving mechanism in the aggressiveness of Keap1-deficient lung ADs. PMID: 25531322 the LGR4-Rspo1 complex crystal structure shows divergent mechanisms of ligand recognition by leucine-rich repeat G-protein-coupled receptors PMID: 25480784 our results suggest a previously unknown Stat3-LGR4 molecular network, which may control osteosarcoma development and progression PMID: 24455684 RSPO-LGR4 not only induces the clearance of RNF43/ZNRF3 to increase Wnt receptor levels but also recruits IQGAP1 into the Wnt signaling complex. PMID: 24639526 Lgr4, which regulates eye, kidney, testis, ovary, and uterine organ development as well as mental development through genetic and epigenetic surveillance, is a novel candidate gene for the pathogenesis of AGR syndrome PMID: 24519938 GPR48 overexpression promotes cancer cell proliferation via activation of Wnt signaling. PMID: 24083742 Lgr4 overexpression promoted glioma cell proliferation through activation of Wnt signaling. PMID: 24083766 Upregulation of GPR48 resulted in increased phosphorylation of glycogen synthase kinase 3beta. PMID: 23803691 A functional low-frequency human LGR4 variant (A750T) has been associated with body mass index in a Chinese obese-versus-control study. PMID: 24212090 Multi-functional norrin is a ligand for the LGR4 receptor. PMID: 23444378 the c.376C>T mutation is associated with low BMD and osteoporotic fractures, electrolyte imbalance, late onset of menarche, reduced testosterone levels, and an increased risk of squamous cell carcinoma of the skin and biliary tract cancer PMID: 23644456 Lgr4/Gpr48 plays a critical role in modulating the TLR2/4 signaling pathway and represents a useful therapeutic approach of targeting Lgr4/Gpr48 in TLR2/4-associated septic shock and autoimmune diseases. PMID: 23589304 R-Spondin potentiates Wnt/beta-catenin signaling through orphan receptors LGR4 and LGR5 PMID: 22815884 LGR4 and LGR5 bind the R-spondins with high affinity and mediate the potentiation of Wnt/beta-catenin signaling by enhancing Wnt-induced LRP6 phosphorylation. PMID: 21693646 GPR48 may play an important role in invasiveness and metastasis of carcinoma and might represent a potential prognostic marker or therapeutic target. PMID: 17178856 Testicular efferent ducts in the mutant mouse are dramatically shortened and less convoluted than in the wild-type animal, providing an explanation to the phenotype observed in LGR4KO. PMID: 19301269 Data show that GPR48 shRNA can inhibit in vitro invasion and in vivo metastasis of HeLa cells efficiently. PMID: 19550120

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

📧 inquiry@betalifesci.com 📞 +1(201) 888-7983

Contact Us Now for Inquiries, Orders, and Questions

Recombinant Human Leucine-Rich Repeat-Containing G-Protein Coupled Receptor 4 (LGR4) Protein (His)

Recombinant Human Leucine-Rich Repeat-Containing G-Protein Coupled Receptor 4 (LGR4) Protein (His)

Product Overview

Target Details

FAQs