Recombinant Human Left-Right Determination Factor 2 (LEFTY2) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-05120P

Greater than 85% as determined by SDS-PAGE.
Recombinant Human Left-Right Determination Factor 2 (LEFTY2) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-05120P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Left-Right Determination Factor 2 (LEFTY2) Protein (His&Myc) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | O00292 |
Target Symbol | LEFTY2 |
Synonyms | EBAF; Endometrial bleeding associated factor (left right determination factor A transforming growth factor beta superfamily); Endometrial bleeding associated factor; Endometrial bleeding-associated factor; Left right determination factor 2; Left right determination factor A; Left-right determination factor 2; Left-right determination factor A; LEFTA; LEFTY 2; LEFTY2; LEFTYA; LFTY2 transforming growth factor; beta -4; LFTY2; mouse; homolog of; LFTY2_HUMAN; MGC46222; Protein lefty 2; Protein lefty A; Protein lefty-2; Protein lefty-A; Protein lefty2; PSEC0024; TGF beta 4; TGF-beta-4; TGFB4; Transforming growth factor beta 4; Transforming growth factor beta-4 |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | N-10His&C-Myc |
Target Protein Sequence | RFSQSFREVAGRFLASEASTHLLVFGMEQRLPPNSELVQAVLRLFQEPVPKAALHRHGRLSPRSAQARVTVEWLRVRDDGSNRTSLIDSRLVSVHESGWKAFDVTEAVNFWQQLSRPRQPLLLQVSVQREHLGPLASGAHKLVRFASQGAPAGLGEPQLELHTLDLRDYGAQGDCDPEAPMTEGTRCCRQEMYIDLQGMKWAKNWVLEPPGFLAYECVGTCQQPPEALAFNWPFLGPRQCIASETASLPMIVSIKEGGRTRPQVVSLPNMRVQKCSCASDGALVPRRLQP |
Expression Range | 77-366aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 39.8 kDa |
Research Area | Cancer |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Required for left-right (L-R) asymmetry determination of organ systems in mammals. May play a role in endometrial bleeding. |
Subcellular Location | Secreted. |
Protein Families | TGF-beta family |
Database References | HGNC: 3122 OMIM: 601877 KEGG: hsa:7044 STRING: 9606.ENSP00000355785 UniGene: PMID: 29268772 |