Recombinant Human Large Neutral Amino Acids Transporter Small Subunit 1 (SLC7A5) Protein (His-SUMO&Myc)

Name: Recombinant Human Large Neutral Amino Acids Transporter Small Subunit 1 (SLC7A5) Protein (His-SUMO&Myc)
Brand: Beta LifeScience
SKU: BLC-01811P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Large Neutral Amino Acids Transporter Small Subunit 1 (SLC7A5) Protein (His-SUMO&Myc) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	Q01650
Target Symbol	SLC7A5
Synonyms	4F2 light chain CD98 light chain Integral membrane protein E16 L-type amino acid transporter 1 Solute carrier family 7 member 5 y+ system cationic amino acid transporter
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-10His-SUMO&C-Myc
Target Protein Sequence	AEEKEEAREKMLAAKSADGSAPAGEGEGVTLQRNI
Expression Range	16-50aa
Protein Length	Partial
Mol. Weight	19.7 kDa
Research Area	Signal Transduction
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	The heterodimer with SLC3A2 functions as sodium-independent, high-affinity transporter that mediates uptake of large neutral amino acids such as phenylalanine, tyrosine, L-DOPA, leucine, histidine, methionine and tryptophan. Functions as an amino acid exchanger. May play a role in the transport of L-DOPA across the blood-brain barrier. May act as the major transporter of tyrosine in fibroblasts (Probable). May mediate blood-to-retina L-leucine transport across the inner blood-retinal barrier. Can mediate the transport of thyroid hormones triiodothyronine (T3) and thyroxine (T4) across the cell membrane. When associated with LAPTM4B, the heterodimer formed by SLC3A2 and SLC7A5 is recruited to lysosomes to promote leucine uptake into these organelles, and thereby mediates mTORC1 activation. Involved in the uptake of toxic methylmercury (MeHg) when administered as the L-cysteine or D,L-homocysteine complexes. Involved in the cellular activity of small molecular weight nitrosothiols, via the stereoselective transport of L-nitrosocysteine (L-CNSO) across the membrane.; (Microbial infection) In case of hepatitis C virus/HCV infection, the complex formed by SLC3A2 and SLC7A5/LAT1 plays a role in HCV propagation by facilitating viral entry into host cell and increasing L-leucine uptake-mediated mTORC1 signaling activation, thereby contributing to HCV-mediated pathogenesis.
Subcellular Location	Apical cell membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein. Lysosome membrane; Multi-pass membrane protein.
Protein Families	Amino acid-polyamine-organocation (APC) superfamily, L-type amino acid transporter (LAT) (TC 2.A.3.8) family
Database References	HGNC: 11063 OMIM: 600182 KEGG: hsa:8140 STRING: 9606.ENSP00000261622 UniGene: PMID: 29198077 Data suggest that amino acid uptake via ASCT2/SLC1A5 is required for cell proliferation/tumor growth independently of LAT1/SLC7A5; in part, these studies were conducted in lung and colon adenocarcinoma cell lines and involved gene knockout techniques. (ASCT2/SLC1A5 = solute carrier family-1 member-5; LAT1/SLC7A5 = solute carrier family-7 member-5) PMID: 29326164 review the upstream regulators of LAT1 and the downstream effects caused by the overexpression of LAT1 in cancer cells. PMID: 30103560 These preclinical results show that LAT1 inhibition is a novel therapeutic approach in the context of thyroid cancers, and more interestingly in untreatable thyroid cancers. PMID: 30241549 These data collectively establish that in an in vitro context, human epithelial and mesenchymal hepatocellular carcinoma cell lines adapt to ASCT2 or LAT1 knockout. PMID: 30029480 SLC7A5 gene plays a role in promoting tumor development, which is regulated by the TGF-beta1 signaling pathway. PMID: 28626091 LAT1 is located close to the plasma membrane in skeletal muscle fibres and in close proximity to the microvasculature. Note a greater immunoreactivity of this protein in the sarcoplasm of type II fibres, potentially supporting the greater anabolic potential in these fibres. PMID: 29278358 LAT1-NAD+-SIRT1 signaling is activated in tumor tissues of patients with non-small cell lung cancer; NAD+ synthesis regulates the SIRT1-FOXO1 apoptotic pathway in response to NQO1 PMID: 27566573 Thus, our results indicated that lncRNA-PVT1-5 may function as a competing endogenous RNA (ceRNA) for miR-126 to promote cell proliferation by regulating the miR-126/SLC7A5 pathway, suggesting that lncRNA-PVT1-5 plays a crucial role in lung cancer progression and lncRNA-PVT1-5/miR-126/SLC7A5 regulatory network may shed light on tumorigenesis in lung cancer. PMID: 29277611 Study showed that a positive [18F] FDOPA uptake in PET was associated with a minimal threshold of LAT1 expression, but did not find a linear correlation between intensity of [18F] FDOPA uptake and level of LAT1 expression. PMID: 28937983 this study shows that IL-2-induced expression of CD98 is a prerequisite for NKG2D-mediated activation of NK cells PMID: 28784848 These results demonstrate a novel fundamental role of LAT1 to support the protein expression of 4F2hc via a chaperone-like function in chorionic trophoblasts. PMID: 28320871 MTA1 expression was positively correlated with LAT1 (p=0.013) and CD34 (p=0.034) expression, but not with Ki-67 (p=0.078). MTA1 shows promise as a diagnostic and prognostic marker in esophageal cancer, and we anticipate that the gene will also prove to be a good therapeutic target. PMID: 28739699 LAT1 overexpression was common in Brain Metastases and was specific for Brain Metastases as compared to healthy brain. These results could explain the specific Brain Metastases uptake on PET-AA. PMID: 27276226 LAT1 and LAT2 were overexpressed in both pheochromocytoma and medullary thyroid carcinoma by comparison with normal tissues. PMID: 27224648 he findings in this study indicate a regulation relationship between CRKL and SLC7A5, and provide useful evidence for gastric cancer therapeutic strategies. PMID: 27846244 Study shows that the solute carrier transporter 7a5 (SLC7A5), a large neutral amino acid transporter localized at the blood brain barrier (BBB), has an essential role in maintaining normal levels of brain branched-chain amino acids; also identified several patients with autistic traits and motor delay carrying deleterious homozygous mutations in the SLC7A5 gene. PMID: 27912058 The LAT1 isoform was confirmed as the major tyrosine transporter in patients with schizophrenia. However, the kinetic parameters (maximal transport capacity, affinity of the binding sites, and diffusion constant of tyrosine transport through the LAT1 isoform) did not differ between patients with schizophrenia and controls. PMID: 28190014 Expression levels of CD98 and beta1-integrin-A (the activated form of beta1-integrin) were significantly increased in hepatocellular carcinoma (HCC) tissues relative to those of normal liver tissues. PMID: 27834933 Authors demonstrate that LAT1 is a critical transporter for human thymic carcinoma cells. LAT1 was strongly expressed in human thymic carcinoma tissues. PMID: 27567475 Our study demonstrates that suppression of l-type amino acid transporter-1 activity using JPH203 might be used as a new therapeutic strategy for cholangiocarcinoma treatment. PMID: 28347255 This study shows the utility of (18)F-FBPA as a tumor-specific probe of LAT1 with low accumulation in the inflammatory lesions. PMID: 27550420 the discovery of CD98 protein on the cell surface of the majority of malignant melanomas, is reported. PMID: 26850337 High SLC7A5 expression is associated with myelodysplastic syndrome. PMID: 26657287 LAT1 is not a leucine sensor. PMID: 26724922 Proliferation of breast cancer cells is dependent on the expression of both LAT1 and AHR. PMID: 26944194 CD98 promotes cell spreading and tumorigenicity by triggering integrin clustering and enhancing cell adhesion to the extracellular matrix. PMID: 26437640 Propose regulation of placental SNAT2/LAT1 ubiquitination by mTORC1 and Nedd4-2. PMID: 26608079 Independently of Gleason score, aberrant overexpression of LAT1 in prostatic adenocarcinoma could predict LP under EM. Although prostate biopsy samples are small, LAT1 may be a novel prognostic biomarker of LP. PMID: 25835180 LAT1 is the transport competent unit of the LAT1/CD98 heterodimeric amino acid transporter. PMID: 26256001 LAT1 can serve as a significant prognostic factor to predict a poor outcome and it may therefore play an important role in the aggressiveness of cutaneous melanoma. PMID: 26237765 exposure to diesel exhaust particle extract induces functional overexpression of the amino acid transporter LAT1/CD98hc in lung cells PMID: 26621329 LAPTM4b recruits LAT1-4F2hc to lysosomes, leading to uptake of leucine into lysosomes. PMID: 25998567 These results suggest that LAT1 expression is associated with disease progression in gastric carcinoma. PMID: 25908107 LAT1 and LAT2 are present and functional in the syncytiotrophoblast MVM, whereas LAT2 is also expressed in the BM and in the fetal capillary endothelium. PMID: 26050671 miR-126 plays a pivotal role in GC (gastric cancer) suppressing the process of GC cell, and this function is at least partly taken to implement by miR-126s's post-transcriptional effect on LAT-1. PMID: 26054677 shRNA-mediated knockdown of Lat1 results in tumor growth inhibition and points to Lat1 as a potential therapeutic target. PMID: 25979827 data, therefore, suggest that FET is trapped within cells due to the asymmetry of its intra- and extracellular recognition by LAT1. PMID: 25385314 Metabolic changes accompanying activation of T cells must occur simultaneously with the reorganization of LAT1 and other transporters that are capable of providing sufficient nutrients to the cell. (Review) PMID: 25597310 CAP-D3 down-regulates transcription of genes that encode amino acid transporters (SLC7A5 and SLC3A2) to promote bacterial autophagy by colon epithelial cells. PMID: 25701737 aberrant overexpression of LAT1 in bile duct adenocarcinoma predicts poor prognosis, suggesting that LAT1 may be a potential target of anticancer therapy. PMID: 24890221 Seven SNPs in SLC7A5 and 20 in SLC7A8 were genotyped. Multiple analyses indicated that 1 SNP in the first intron of SLC7A5, rs4240803, was significantly associated with TPN use. PMID: 24704384 CD147 and CD98 might play important roles in cyclophilin-induced cell migration. PMID: 25089027 The study shows that the expression of LAT1 on myeloma cells is significantly associated with high proliferative activity as well as poor prognosis in patients with newly diagnosed multiple myeloma. PMID: 25220100 L-type amino acid transporter 1 expression increases in well-differentiated but decreases in poorly differentiated endometrial endometrioid adenocarcinoma and shows an inverse correlation with p53 expression. PMID: 24694899 LAT1 and its associated protein, 4F2hc, are up-regulated and miR-7 expression was regulated by LAT1. PMID: 24726839 Polymorphisms of the LAT1 gene, there was no evidence for either allelic and/or genotypic association with the risk of NSCL/P in the Polish population. PMID: 24606907 Studied the clinicopathological significance of LAT1 expression in adenoid cystic carcinoma (ACC). PMID: 23516127 LAT1 was expressed in gonad tissues and several kinds of cells having special functions, as well as being discovered to be an aspect of oncofetal protein. PMID: 23824658 LAT-1 may function as an oncogene in gastric cancer. PMID: 23809372

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.