Recombinant Human Large Neutral Amino Acids Transporter Small Subunit 1 (SLC7A5) Protein (His-SUMO&Myc)
Beta LifeScience
SKU/CAT #: BLC-01811P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Large Neutral Amino Acids Transporter Small Subunit 1 (SLC7A5) Protein (His-SUMO&Myc)
Beta LifeScience
SKU/CAT #: BLC-01811P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Large Neutral Amino Acids Transporter Small Subunit 1 (SLC7A5) Protein (His-SUMO&Myc) is produced by our E.coli expression system. This is a protein fragment. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | Q01650 |
| Target Symbol | SLC7A5 |
| Synonyms | 4F2 light chain CD98 light chain Integral membrane protein E16 L-type amino acid transporter 1 Solute carrier family 7 member 5 y+ system cationic amino acid transporter |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-10His-SUMO&C-Myc |
| Target Protein Sequence | AEEKEEAREKMLAAKSADGSAPAGEGEGVTLQRNI |
| Expression Range | 16-50aa |
| Protein Length | Partial |
| Mol. Weight | 19.7 kDa |
| Research Area | Signal Transduction |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | The heterodimer with SLC3A2 functions as sodium-independent, high-affinity transporter that mediates uptake of large neutral amino acids such as phenylalanine, tyrosine, L-DOPA, leucine, histidine, methionine and tryptophan. Functions as an amino acid exchanger. May play a role in the transport of L-DOPA across the blood-brain barrier. May act as the major transporter of tyrosine in fibroblasts (Probable). May mediate blood-to-retina L-leucine transport across the inner blood-retinal barrier. Can mediate the transport of thyroid hormones triiodothyronine (T3) and thyroxine (T4) across the cell membrane. When associated with LAPTM4B, the heterodimer formed by SLC3A2 and SLC7A5 is recruited to lysosomes to promote leucine uptake into these organelles, and thereby mediates mTORC1 activation. Involved in the uptake of toxic methylmercury (MeHg) when administered as the L-cysteine or D,L-homocysteine complexes. Involved in the cellular activity of small molecular weight nitrosothiols, via the stereoselective transport of L-nitrosocysteine (L-CNSO) across the membrane.; (Microbial infection) In case of hepatitis C virus/HCV infection, the complex formed by SLC3A2 and SLC7A5/LAT1 plays a role in HCV propagation by facilitating viral entry into host cell and increasing L-leucine uptake-mediated mTORC1 signaling activation, thereby contributing to HCV-mediated pathogenesis. |
| Subcellular Location | Apical cell membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein. Lysosome membrane; Multi-pass membrane protein. |
| Protein Families | Amino acid-polyamine-organocation (APC) superfamily, L-type amino acid transporter (LAT) (TC 2.A.3.8) family |
| Database References | HGNC: 11063 OMIM: 600182 KEGG: hsa:8140 STRING: 9606.ENSP00000261622 UniGene: PMID: 29198077 |
