Recombinant Human Laminin Subunit Gamma-2 (LAMC2) Protein (His-GST&Myc)
Beta LifeScience
SKU/CAT #: BLC-11032P
Greater than 85% as determined by SDS-PAGE.
Recombinant Human Laminin Subunit Gamma-2 (LAMC2) Protein (His-GST&Myc)
Beta LifeScience
SKU/CAT #: BLC-11032P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Laminin Subunit Gamma-2 (LAMC2) Protein (His-GST&Myc) is produced by our E.coli expression system. This is a protein fragment. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | Q13753 |
| Target Symbol | LAMC2 |
| Synonyms | 3918; B2T; BM600; Cell-scattering factor 140 kDa subunit; CSF 140 kDa subunit; CSF; EBR2; EBR2A; Epiligrin subunit gamma; Kalinin subunit gamma; Kalinin/nicein/epiligrin 100 kDa subunit; Ladsin 140 kDa subunit; LAMB2T; LAMC2; LAMC2_HUMAN; Laminin 5 gamma 2 subunit; Laminin B2t chain; Laminin gamma 2; laminin gamma 2 chain; Laminin subunit gamma-2; Laminin-5 subunit gamma; LAMNB2; Large adhesive scatter factor 140 kDa subunit; MGC138491; MGC141938; Nicein subunit gamma; NICEIN-100KDA |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-10His-GST&C-Myc |
| Target Protein Sequence | NCQGGGACDPDTGDCYSGDENPDIECADCPIGFYNDPHDPRSCKPCPCHNGFSCSVMPETEEVVCNNCPPGVTGARCELCADGYFGDPFGEHGPVRPCQPCQCNNNVDPSASGNCDRLTGRCLKCIHNTAGIYCDQCKAGYFGDPLAPNPADKCRACNCNPMGSEPVGCRSD |
| Expression Range | 417-588aa |
| Protein Length | Partial |
| Mol. Weight | 53.3 kDa |
| Research Area | Neuroscience |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Binding to cells via a high affinity receptor, laminin is thought to mediate the attachment, migration and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components. Ladsin exerts cell-scattering activity toward a wide variety of cells, including epithelial, endothelial, and fibroblastic cells. |
| Subcellular Location | Secreted, extracellular space, extracellular matrix, basement membrane. Note=Major component. |
| Database References | HGNC: 6493 OMIM: 150292 KEGG: hsa:3918 STRING: 9606.ENSP00000264144 UniGene: PMID: 29315846 |
